(data stored in ACNUC7421 zone)

EMBL: CP001115.PE205

CP001115.PE205       Location/Qualifiers
FT   CDS_pept        267525..267944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01581"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01581"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47603"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2G4"
FT                   /protein_id="ACO47603.2"
FT                   /translation="MPRLTPDETTAVLKRHQQMRGGVLRLARLRYETALHPPTPDLVVQ
FT                   LDAPDLDSSSGWCRMSLTLEGVATLWLREDEATNMVLLGGLAIVYAGDRVYVDFSPPAV
FT                   DGYDLTDFSTSTFSVSAKALWVQVSPLDAAVPDPA"
     atgccgcgcc tcacgcccga tgaaaccact gctgttctga aacgccatca gcagatgcgc        60
     gggggcgtcc tgcgtctagc ccgcctgcgg tacgaaacag ctcttcatcc ccctacgcca       120
     gaccttgtgg tgcaactcga tgctccagac cttgacagtt catccggttg gtgccgcatg       180
     agcctgaccc tcgagggggt ggctacgcta tggctgcggg aagacgaggc cacgaacatg       240
     gtgctgcttg ggggtctggc catcgtatac gccggtgacc gggtctacgt cgatttcagt       300
     cctcctgctg tggacgggta cgacctgacg gatttttcca catcaacttt cagtgtcagc       360
     gccaaagcac tgtgggtaca ggtctcgcca ttggacgcag cagttccaga cccagcctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page