(data stored in ACNUC7421 zone)

EMBL: CP001115.PE208

CP001115.PE208       Location/Qualifiers
FT   CDS_pept        270385..272157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01584"
FT                   /product="conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01584"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47606"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2G7"
FT                   /protein_id="ACO47606.1"
FT                   /translation="MSFPRTFRALTLALLLGASASAASSPDLLISPTGDVTIAGRSVQL
FT                   RTAPQFIEGALLVPLRETAALLGRNVQVSGTLMQVGRLVVQTSNRTMTIDGVPYAGALV
FT                   VTPGGDPLVEARLLAYALDGQLVTRPGGAVALTGVPAQGTPAVSTPAPVNPPITSPAPP
FT                   PSTPAPQPAGAGLPEARFATNKTVYAPGERVVYTDFSFDQDGLNLARQWTGAEEVFFTP
FT                   GEHRITLTVTNSKGRVSAPFTRIVQVQGAPVNTPLSYALRHTPIGSTFKDTLNPAYPAV
FT                   TPVTQAGASFPLLFSDSPETPTQSGVLYQDRASGRVRVVAYHINRLPRPARLYVLARPR
FT                   SAAAAVQVLRGGSAGGTRIESVLGQVSVLDFLTGTGSPRQQLSTSGVTALYTSPLLTPE
FT                   QGATALLDLHITGEADLSVVMLEEGRPLTDETLRALPVLPPDAQHQRGTFPGAVRSLTV
FT                   RVGSSPARLTLGDNLSDPALSGVDATTGAPQRLSGNYGVQYDITVENSVPGNSTVATFV
FT                   PRGGAYRGGLTVEDGQDRQIIRIPGSGVLTNGDHPMMLWKTRSRSFRLSFIPTGGSFLP
FT                   VSLVFYPHQGELRP"
     gtgtcgtttc cccgtacctt ccgcgccctg actcttgccc tgctgcttgg cgcatcagcg        60
     tcagcggcca gcagtccaga cctgctgatc tcccctaccg gggacgtcac gattgccggt       120
     cgcagcgttc aattacgtac tgccccgcag tttattgagg gtgcgctgct ggtgcctctg       180
     cgtgaaactg ccgccctgct gggccgaaac gtacaggtca gcggaaccct gatgcaggtt       240
     ggacgactgg tggtccagac cagcaaccgg accatgacta ttgacggtgt tccctatgct       300
     ggcgcactgg tcgtcacccc gggtggagac ccgctcgtgg aggcacgcct gctggcatac       360
     gccctcgacg ggcagctggt cacccggccg gggggcgctg tagccctgac gggcgttcca       420
     gcgcaaggca ccccagctgt cagcacgccg gcgccagtca atccacccat tacttcaccg       480
     gcgccgccgc cgtccactcc tgcgcctcag ccagcaggag ccggcctccc ggaagcgcgt       540
     tttgcaacca ataaaacagt ctacgctccc ggagaacggg ttgtttacac cgatttctcc       600
     ttcgaccagg acgggctgaa tctggcgcgg caatggaccg gcgcggagga agtgttcttt       660
     acccccggcg agcaccgcat aacgctgacg gtgacgaaca gtaagggccg ggtcagtgcg       720
     ccgttcaccc gaattgttca ggtgcagggc gccccggtga acacaccact ctcgtatgcg       780
     ctgcgccata cccccattgg ctcgaccttc aaagacaccc ttaatcctgc ctaccccgcc       840
     gtgacgcccg taacccaggc aggcgcttct ttcccactgc tgttcagcga ctccccggaa       900
     acacctaccc aaagcggcgt gctgtaccag gaccgggcgt ccgggcgggt gcgcgtcgtg       960
     gcctaccaca tcaaccggct ccccagaccc gcacgcctgt atgtcctggc gcggccccgc      1020
     agcgcggcag ccgccgtgca ggtccttcgc ggaggcagcg ctggaggcac gcgcatagaa      1080
     agcgtgcttg gacaggtgag tgtgctggac tttctgaccg gtaccggctc tcctcgtcag      1140
     cagctcagca cttcaggcgt aacggcgctg tataccagcc cactgctgac gcctgaacag      1200
     ggagccacag cgctgcttga cctgcacatt accggtgagg ctgacctcag cgtggtcatg      1260
     cttgaggagg gcaggccgct gaccgacgag accctcaggg cccttccagt tctgccacct      1320
     gacgctcaac atcaacgcgg cacattccca ggggcagtac gcagcctcac tgtacgggta      1380
     gggtcctcac ctgcacgctt gacgctgggc gacaacctga gtgacccggc gctcagtggt      1440
     gtggacgcaa ccaccggggc gccgcagcgc ctgagcggca attacggggt tcagtacgac      1500
     atcacggtcg agaactccgt ccccggcaac agcaccgtag ccacgttcgt gccgcgtggt      1560
     ggcgcttacc gcggcggcct gaccgtagag gacggacagg accgtcagat catcagaatt      1620
     cccggttcag gggtcctgac caatggtgac cacccgatga tgttgtggaa gacgcggtcg      1680
     agatccttcc ggctttcttt tattcctacg ggaggctcat tcctcccggt ttccctggtg      1740
     ttctacccgc accagggtga gctcaggccc tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page