(data stored in ACNUC7421 zone)

EMBL: CP001115.PE209

CP001115.PE209       Location/Qualifiers
FT   CDS_pept        complement(272491..273546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01585"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01585"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47607"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2G8"
FT                   /protein_id="ACO47607.1"
FT                   /translation="MELLEIRLGLADAPGPSHGSEQRSARPGSSRAQASPGRGQPAAGG
FT                   QKHGTSASTVDFEVLLFQHLSGAERRRLLHGPRFSQGLFQAVRGTSAYSRLLAEAHALD
FT                   VSNIGVRLGDQTLMQWLDRILSRQGSRVKCRAAAQTIYDDLVSYCRLEYVTYTREDRQA
FT                   TQRDQSQEEARRVGEARRQAAEARRDRERRAQSRRRKAEEARHARGGESASQQSAGTRT
FT                   SSQEPFGTADQSRRPSATTQESVVFFREFHHLAEARLYLRVARLQVGLQGHVRSFSRNR
FT                   VFVVELVVPSTLKEAVDLSYQRALSALQGAAERIRAEAAAARDEAIRQAEAAYAEQYEQ
FT                   AFEIAVERYTS"
     atggaacttc tggaaatcag gcttgggctg gcagacgcgc ccggcccttc acatgggagt        60
     gagcagcgtt ctgcacgacc gggctcctcc agagcacagg cgtcacccgg gcgcggccag       120
     ccggccgccg ggggccagaa gcacgggaca tcagcgtcaa ccgtcgactt tgaagtgctg       180
     ctgtttcagc atctcagcgg tgcagagcgc agaaggctgc tgcatggtcc ccgcttcagt       240
     cagggcctgt tccaggctgt caggggcacc agcgcctatt cacggctgct ggcggaagca       300
     catgcgctgg acgtgtcgaa tattggcgtc aggcttggtg atcagacact gatgcagtgg       360
     cttgaccgga ttttgtcccg gcaggggtcg cgcgtgaagt gcagggcggc ggcacagacc       420
     atctacgatg acctggtgtc gtactgccgg ttggagtacg tgacgtatac ccgggaggac       480
     cggcaggcca cccaacgcga tcagtcgcag gaggaggcgc gccgcgtcgg ggaggccagg       540
     cgtcaggcgg ctgaagctcg ccgtgaccgg gaacgcaggg ctcagtccag gcgccggaaa       600
     gcagaagaag cgcggcacgc acgtggaggt gagagcgcca gccagcagag cgctggtacc       660
     aggacctcca gccaggaacc gtttggcacc gctgatcagt cgcgcaggcc gtcagctacg       720
     acacaggagt ccgttgtctt tttcagggag tttcatcatc tggctgaagc acgtctgtac       780
     ctgagggtcg ccaggttaca ggtcgggttg cagggacatg tacggtcatt cagccgcaac       840
     agggtgtttg tcgtcgagct tgtggtgccg tccaccctga aagaagctgt tgatctgagc       900
     taccagcggg ccttgtctgc cctgcaggga gcagccgaga gaatccgtgc tgaggcagca       960
     gcggcgcggg acgaggccat caggcaggcc gaggctgctt atgccgagca gtacgaacag      1020
     gccttcgaga ttgcggtcga gcggtatacc tcgtaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page