(data stored in ACNUC7421 zone)

EMBL: CP001115.PE210

CP001115.PE210       Location/Qualifiers
FT   CDS_pept        273649..273957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01586"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01586"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47608"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2G9"
FT                   /protein_id="ACO47608.1"
FT                   /translation="MRGRDTLPVNLDGLVDRPLAICPAPRTAILCLRSRHFVFWAPTPQ
FT                   PEQPSHNRTVQCGRPGPAPELCRSAGPMRETAVPSGDILPHWNVRHQRKEVCSRRLL"
     atgcggggta gagacaccct gcctgtaaac cttgacggcc ttgtcgaccg ccctctggcg        60
     atctgtccgg ctccccgaac tgcgatcctc tgtcttaggt ccaggcattt cgtcttctgg       120
     gcgccgacgc cacagcctga gcagccttcc cacaacagaa ccgtgcagtg tggcaggcca       180
     ggcccagcgc ctgaactttg ccgttcggca ggacccatga gagagacagc tgttccatcg       240
     ggagatattc tgccgcactg gaatgtgagg caccagagga aggaagtgtg ttcgagacgc       300
     cttttatga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page