(data stored in ACNUC7421 zone)

EMBL: CP001115.PE215

CP001115.PE215       Location/Qualifiers
FT   CDS_pept        278735..280192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01630"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47613"
FT                   /db_xref="GOA:C1D2H4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2H4"
FT                   /protein_id="ACO47613.1"
FT                   /translation="MRAVHAPPPVVLALDLGSSSVKGAAFDIHGRVLAGLEAHENVSLH
FT                   YAAGGAAEVPLADLVAAAEAVLDRLHGRLGSRSVLAVAMTSIASSLVALDARGEPVGPV
FT                   LSYADTRSAGEVRAVETLTSREETGCPAFSAYWPAQVRWWQGAHPELPAEHFCSVPDFL
FT                   LMRWTGELVTSYSLASWTGLLDRETLDWNMRALSTAGLSAAQLPRLGDHDTRLTLQSRW
FT                   TDRWPKLAGVPFHPGVADGATANVGSGALTPGRPAITIGSTSAVRLAVQGAPPPIPSGL
FT                   WSYRIDRNTHLLGGALTEGGNLYSWLQSTLRLDRRLDEELLGMAPGAHGLTFVPSLGGT
FT                   RSPDYDPHARGTLHGLSYATTPAQITRAAMEGVACRLANVAWRLPVSDDALFVASGRAL
FT                   LASRAWPQMLADALGRPLLLEDIRAGASARGAALLALRAQGVEISTDPVAQRVVEPVPA
FT                   HHEVYRTMCARMDRLTRLMREDEELVS"
     atgagggccg tgcacgcccc gcctccggtc gtgctggccc tggatctggg cagcagcagc        60
     gtcaagggcg ccgcgttcga catccacggc cgcgtcctgg ctggtctgga agcccacgag       120
     aacgtctcat tgcactacgc cgctggtggc gctgctgagg tgccgctcgc ggacttggtg       180
     gccgctgcgg aggcggtgct tgaccggctt catggacggc tgggcagccg gtccgtcctg       240
     gctgtggcca tgacctccat cgcgagcagc cttgtggcgc tcgacgcgcg gggcgaaccg       300
     gtgggtccgg tcctgtccta cgctgacacc cgctctgctg gtgaggtgag ggccgttgag       360
     accctgacct cccgggaaga gaccggctgt ccggccttca gtgcttactg gcccgcacag       420
     gtgcgctggt ggcaaggagc ccacccggaa ttgcccgccg agcacttctg ctcggtgccg       480
     gatttcctgc tgatgcgctg gacgggagag ctcgtgacga gctactcgct cgcgtcctgg       540
     actggcctgc tggaccggga aaccctcgac tggaacatgc gggcgctgag cacggcgggc       600
     ttgagcgcgg ctcaactgcc ccggctcggt gaccatgaca cccggcttac cctgcagtcc       660
     cgctggacgg accgctggcc caaactcgcg ggcgtgccct ttcatccagg cgtggccgac       720
     ggcgccaccg ccaatgttgg gagcggcgca ctcaccccgg ggcgccctgc catcacgatt       780
     ggcagcacca gtgccgtccg cctcgctgtg cagggcgcgc cacccccgat cccgtcgggg       840
     ctgtggtcct accgcattga ccggaacacc cacctcctgg gcggagcact gacagagggt       900
     ggcaacctct actcgtggct acagtcgacg cttcgcctgg accggcggct ggatgaagag       960
     ctgctcggca tggccccggg cgctcacggc ctgacctttg tgccttcgct gggcggcacc      1020
     cgcagccccg attacgatcc acacgcccgc ggaacgcttc acggtctgag ttatgccacc      1080
     acacctgcac agatcacgcg ggctgctatg gaaggagtgg cctgccgcct tgcgaacgtg      1140
     gcgtggcgcc tgccggtcag tgatgacgcc ctgtttgtcg ccagtggccg ggccctgctt      1200
     gcttcgcggg cgtggccgca gatgcttgcc gacgccctgg gccggccgct cctgctcgaa      1260
     gacatccgcg ccggagccag cgcccggggc gcggccctgc tggccttacg ggcccagggg      1320
     gtagaaattt ccaccgaccc tgtcgcgcag cgcgtggtcg agccggtgcc tgcacatcac      1380
     gaggtctacc gcacaatgtg cgcccgaatg gaccggctga cccggctgat gcgcgaggat      1440
     gaggagctgg tctcgtga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page