(data stored in ACNUC7421 zone)

EMBL: CP001115.PE217

CP001115.PE217       Location/Qualifiers
FT   CDS_pept        280809..281747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01650"
FT                   /product="putative 2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47615"
FT                   /db_xref="GOA:C1D2H6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2H6"
FT                   /protein_id="ACO47615.1"
FT                   /translation="MSEGGVLTFGEALLKLALPQAHRIEDMRAIRAECGGSELNVAAAL
FT                   RALGRPAAWISALPDGPLGDWARAQVRMLGVQDFSVERSGRLGSFYLEDHHPPRPSRVI
FT                   YDRQGTAFQALTAADLSPSWLTGQVAFHVSGISLALGPGPQELALALVTAARERKVLVS
FT                   FDVNHRRKLLPDAAAVQTYGPAARHADVIFVAQRDAGLLGGVSDLRALNPRALLVVTCG
FT                   AQGSQAHLPGGEIVHQPAFAAAGPGRVGRGDAFAGGFLHAWLGQATPAQALQFASACAA
FT                   LKTTLPGDQLHVSDGDLKAVLAGSESGEPLR"
     atgagcgaag gcggagtcct gacttttggc gaggcgctgc tgaaacttgc cctgccccag        60
     gcacaccgga ttgaagacat gagggccatt cgggccgagt gcggaggttc agaactgaac       120
     gtcgcggcgg ccttgcgcgc cctgggccgt ccagcagcgt ggatcagcgc gttgccggac       180
     ggcccgctgg gtgactgggc acgcgcgcag gtccgcatgc tgggcgttca ggatttcagt       240
     gtcgaacgtt ccggacgctt ggggtcattc tatctggagg accatcaccc gccccgtccc       300
     agccgcgtca tctatgaccg gcagggcacc gcgtttcagg ccctgactgc cgctgacctg       360
     agcccatcct ggctgactgg ccaggtggcc tttcacgtca gcggcatcag tcttgcgctg       420
     ggaccgggcc cacaggagct cgcgctggcg ctggtcacag ccgcccgcga acgtaaagtc       480
     ctggtgtcct ttgacgtgaa ccaccggcgc aagctgctgc ctgacgcggc ggctgtgcag       540
     acgtacggtc ccgccgcgcg gcatgccgac gtgattttcg tcgcgcagcg agacgcgggt       600
     ctgctgggtg gggtgtccga cctgcgggcc ctcaacccac gtgccctgct cgtggtcacc       660
     tgcggtgccc agggcagcca ggcccacctg ccgggcggcg aaattgttca tcagcccgcc       720
     ttcgcggccg ccggtcctgg ccgggtagga cggggagacg cctttgccgg cggcttcctg       780
     catgcctggc tgggacaagc cacacctgct caagcgctgc agttcgcctc ggcgtgtgcg       840
     gcgctgaaaa ccacgcttcc gggtgatcag ctgcacgtca gtgacggtga cctgaaggcg       900
     gtcctggctg gcagtgaaag cggcgagccg ctccgatga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page