(data stored in ACNUC7421 zone)

EMBL: CP001115.PE221

CP001115.PE221       Location/Qualifiers
FT   CDS_pept        complement(284874..285305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47619"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I0"
FT                   /protein_id="ACO47619.1"
FT                   /translation="MTKLTVGPWIAAQKLPNRDVARDRQAFLERVRTRDETPSVAGFPL
FT                   VGLGGSCGKPCFALPYVLSWTDENTRRLEEVADRYDCYVEYGVYPHLKLRENDQEVGAV
FT                   QDWTTFAMVYLRPGYERAQELLVDLAETLRPQEMTTNPK"
     atgaccaaac tgactgtagg cccctggatc gctgctcaga agctgcccaa ccgtgatgtc        60
     gcgcgtgacc gtcaggcgtt tctcgaacgt gtccggaccc gcgacgagac ccctagtgtg       120
     gcgggcttcc cgctcgtcgg cctggggggc agctgcggaa agccgtgctt tgccctgccg       180
     tacgttctga gctggaccga cgagaacacc aggcgcctgg aagaggtcgc cgacagatac       240
     gactgctacg tcgagtacgg cgtgtatccg cacctgaaac ttcgggagaa cgatcaggaa       300
     gttggggcgg tgcaggactg gacgaccttt gccatggtct acctcaggcc cggttatgag       360
     cgtgcccagg aacttcttgt ggacctcgct gaaacactcc ggccgcagga aatgaccact       420
     aacccgaagt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page