(data stored in ACNUC7421 zone)

EMBL: CP001115.PE222

CP001115.PE222       Location/Qualifiers
FT   CDS_pept        complement(285352..287859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01700"
FT                   /product="putative copper-exporting ATPase; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47620"
FT                   /db_xref="GOA:C1D2I1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I1"
FT                   /protein_id="ACO47620.1"
FT                   /translation="MTKTVELGVQGMTCASCVGRVERGLSKVEGVDQATVNLATERATV
FT                   SYDPEKTSPQALMDKVRAIGYEPVVGTLELGVQGMTCANCVGRVERTLKKVDGVLEANV
FT                   NLATERASIRYLPASVSPGQLKAAVRASGYEILENEAGKDRTDQEREVREREVQGLRRA
FT                   VIFSAVFAVPLLLLAMVPMLYMPFHMWLTGYVDMGTLNWIMLALAAPVQFGPGLRFYRL
FT                   GWKSLTHRSPDMNSLVMIGTSAAFFYSLLVTVAPQIFPEGTAHVYYEASAVVITLILLG
FT                   KYFEAIAKGRSSEAMKKLLSLQPKTARVVRQGQEHEVPTDEVLIGDLLAVRPGEKIPVD
FT                   GEVTGGNSFVDESMITGEPVPVNKQAGSSVVGGTINQNGALTFKATRVGADTALAQIIK
FT                   LVETAQGSKPPIQGLADKVVSVFVPVVLGIAALTFVLWMIFGGQTALSFALVNTVAVLI
FT                   IACPCAMGLATPTSIMVGTGKAAELGVLFRNGSALEGLQGVQVVAVDKTGTLTRGRPEL
FT                   TDLVTTPAFDRQQVLGLVAAAEAQSEHPIAQAIVEAARREGITPLTTDHFEAVPGFGLE
FT                   ARVAGHLVQIGADRYMTRLGLDTGAFTAQAHQLGDEGKSPMYAAIDGQLAAIIAVADPI
FT                   KEGSFEAVRALHRQGLKVAMITGDNGRTAHAIARQLGIDEVLAEVLPSGKSDAVKALQA
FT                   QGHKVAFVGDGINDAPALAQADVGLAIGTGTDVAVETADVILMSGDLRGVPNAYALSRA
FT                   TLRNIRLNLFWAFAYNVILIPVAAGVLYPTFGWLLSPVLAAAAMGFSSVFVLTNALRLR
FT                   GFRPPVRPDHVPAHTPASSPLHA"
     atgaccaaaa cagtggaact cggcgtgcag ggcatgacct gcgccagttg tgtcggccgc        60
     gtcgaacgtg gactaagcaa ggttgagggt gtcgaccagg caaccgtcaa cctggccacc       120
     gaacgcgcca ccgtctcgta tgaccccgag aaaaccagtc cccaggcgct gatggacaag       180
     gtcagggcga ttggttacga gcctgtggtg gggacgcttg aactcggcgt gcagggcatg       240
     acctgcgcca actgtgtcgg ccgcgtcgaa cgtactctga aaaaggtcga tggagtgctg       300
     gaagccaacg tcaaccttgc taccgagcgg gcgagtatcc ggtacctgcc ggccagcgtc       360
     agccccgggc agctcaaggc cgccgtgcga gcgtccggct acgagatcct cgaaaacgag       420
     gctgggaaag accgcacaga ccaggaacgc gaagtccggg aacgggaagt tcagggactg       480
     cgccgcgccg tcatcttcag cgccgttttc gctgttccgc tgttgctgct ggctatggtg       540
     ccgatgctgt atatgccctt tcatatgtgg ctgacgggtt acgtggacat gggcacgctg       600
     aactggatca tgctggcgct cgccgctccc gtccagttcg gtcccggtct gcgcttttac       660
     cgtctcggct ggaaaagcct gacgcaccgt tcacctgaca tgaacagcct ggtcatgatc       720
     ggtacttccg ccgcgttctt ttacagcctg ctggtgaccg tcgcacctca gattttccct       780
     gaaggcaccg cgcacgtgta ttacgaggcc agcgctgttg tcatcaccct gattctgctg       840
     ggcaaatact tcgaggccat cgccaaggga cgcagcagcg aagccatgaa gaagctgctc       900
     tccctgcagc ccaaaaccgc ccgtgttgtc cggcaggggc aggaacacga agttcccacc       960
     gatgaagtcc tgataggcga tctgctggcg gtgcgccccg gcgagaaaat cccggtggac      1020
     ggtgaagtta cgggcggcaa cagctttgtc gacgagagca tgatcaccgg cgagcccgtc      1080
     cctgtgaaca aacaggctgg ctcaagcgtc gtaggcggca ccatcaacca gaatggggcc      1140
     cttacgttca aagccaccag ggtcggtgct gataccgcgc tggcccagat catcaagctg      1200
     gtcgaaacgg cccagggcag caagcctccg attcaggggc tggccgataa ggtggtcagt      1260
     gtcttcgtac ctgtcgtgct ggggatcgca gccctgacct tcgtgctgtg gatgattttt      1320
     ggtgggcaga ccgccctgag cttcgcgctg gtcaacacgg tcgcggtact gatcattgcc      1380
     tgtccctgcg ccatgggcct tgcaacaccc accagcatca tggtcggcac cggcaaggct      1440
     gcggagctgg gcgtgctgtt ccgcaacgga tcggcgcttg aaggtcttca gggtgttcag      1500
     gtggtggccg tcgataaaac aggcacgctg accaggggca ggcctgaact cactgatctg      1560
     gtgaccaccc cagcatttga ccgccagcag gtccttggtc ttgtcgcggc cgccgaggcg      1620
     caaagtgagc atcccatcgc ccaggcgatt gtcgaggcgg ccaggcgtga aggaattacc      1680
     cctctgacaa cggaccactt tgaagccgta ccgggatttg gtctggaagc gcgtgtggca      1740
     ggacacctgg tgcagatcgg cgccgaccgg tacatgaccc ggcttggcct cgacactgga      1800
     gcttttaccg cgcaggctca tcagctgggt gacgaaggca agtccccaat gtacgccgcc      1860
     atcgacgggc agcttgcagc catcattgcg gtggcagacc cgatcaagga aggcagcttc      1920
     gaagcggtcc gtgcactgca ccgccagggt ctgaaggtcg cgatgatcac cggcgacaac      1980
     gggcgcaccg cccacgccat cgcgcggcaa ctgggcatcg acgaggtcct tgcagaagtg      2040
     ctgcccagcg gcaagagcga cgcggtgaaa gcccttcagg cccaggggca caaggtggcc      2100
     ttcgtaggtg acggcatcaa cgacgcgccc gccctggccc aggccgatgt tggtctggca      2160
     atcggcaccg gtactgacgt agccgtggag accgccgacg tgatcctcat gagcggcgac      2220
     ctgcgtggtg taccgaacgc ctacgcgctt tcacgggcga ccctgcgcaa tatccgcctg      2280
     aacctgttct gggccttcgc gtacaacgtc atcctgatac cagtggcggc gggtgtgctc      2340
     taccctacgt tcggctggct gctcagtccg gtcctggccg ccgcagcaat gggattttcc      2400
     agtgtctttg tgctgaccaa tgcgcttcgc ctgcgcggct tccgcccgcc ggtccggcca      2460
     gaccacgtgc ccgcacacac gcctgcgtct tctcctctcc acgcctga                   2508
//

If you have problems or comments...

PBIL Back to PBIL home page