(data stored in ACNUC7421 zone)

EMBL: CP001115.PE224

CP001115.PE224       Location/Qualifiers
FT   CDS_pept        288207..288530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47622"
FT                   /db_xref="GOA:C1D2I3"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I3"
FT                   /protein_id="ACO47622.1"
FT                   /translation="MTAAKDKTAACHTPAAGHLCMPEDSRKRAARRLKIARGHLDSIVT
FT                   MLEKDDAYCVDVLRQLKAVQGALSGAGEVVLRGHLEAHVATASTRGDSVEIVEELMEAL
FT                   KYT"
     gtgacggccg cgaaggacaa aaccgcagcg tgccacacgc cggctgcagg gcatctgtgc        60
     atgcccgaag attcccgtaa gcgtgcagcg cggcggctga aaatcgcccg cggccacctc       120
     gacagcattg taaccatgct ggaaaaggat gacgcctact gcgtggacgt gctgcggcag       180
     ctcaaggcag tgcaaggcgc cctgagcgga gcgggcgagg ttgttcttcg cggccacctt       240
     gaggcccatg ttgccactgc ctcgacccgg ggcgacagtg tcgaaatagt cgaagagctg       300
     atggaagcgc tcaagtacac ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page