(data stored in ACNUC7421 zone)

EMBL: CP001115.PE226

CP001115.PE226       Location/Qualifiers
FT   CDS_pept        complement(290865..292259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01730"
FT                   /product="putative chromate transport; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47625"
FT                   /db_xref="GOA:C1D2I6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I6"
FT                   /protein_id="ACO47625.1"
FT                   /translation="MTQLPDRPVLHPREVSFQEATAAWARIAAQSFGGPAGQIAVMHRI
FT                   LVEEKRWISEERFLHALNYCMLLPGPEAQQLAIYIGWLLNGTKGGIVAGCLFVLPGFIS
FT                   ILILSIIYALYQETTLVQAVFFGLKAAVLVIVLDAVLRIGKRALKHPLLVVLAGVAFVS
FT                   IFFFNVPFPLVVLGAGLIGYFGSRVRPEVFQGNGGHGSSAHGEEVRDAVITAETATRVT
FT                   PSWNRFFRITAIGLATWFGPLLLVGALFGFSSVFWLMAKFFSQMAVVTFGGAYAVLAYV
FT                   AQEAVQVFGWLKPGEMLNGLGMAETTPGPLIQVVQYVGFMGAFRDPEGLTPLAAGILAS
FT                   VVVTWATYAPCFLWIFLGAPYIEQLRGNKALSGALTAITAAVVGVILNLSVWFALNTLF
FT                   SRVGETHLGPLRLYTPDWSTLNIPSLVLAVIAGIALFRFKLGAIPTLALTTVLGAAFVL
FT                   LTRSGG"
     gtgacccaat tgcctgacag gccagttctt catccgcgcg aggtgagctt tcaggaggcg        60
     actgccgcct gggcccgcat tgccgctcag agctttgggg gccctgctgg gcagatcgcg       120
     gtgatgcacc gcattctggt cgaagaaaaa cgctggatca gtgaggaacg ctttctgcat       180
     gcactgaact actgcatgct gctgccaggc ccggaagcgc agcagttggc catctacatc       240
     ggctggctgc tgaacggcac gaaaggaggc atcgtcgcag gatgcctttt cgtcctgccg       300
     ggctttattt ccatcctgat ccttagcatc atctatgcgc tctaccagga aacaacactg       360
     gtgcaggctg tgtttttcgg gctcaaggcc gctgtcctgg tcatcgtcct tgacgctgtt       420
     ctccggatag gaaagcgggc cctgaagcac cctcttcttg ttgtgctcgc aggagtggcg       480
     ttcgtttcca tcttcttctt caacgtgccg tttcctctcg tggttcttgg agcaggcctg       540
     atcgggtatt tcggcagccg ggtgcgtcca gaggtgtttc agggaaacgg cgggcacggc       600
     agcagtgcac acggagagga ggtcagggac gccgtcatca ctgcagaaac cgccacccgc       660
     gtaactccaa gctggaacag gttttttcgg atcactgcga tcggactggc cacatggttt       720
     ggtcctctgc tgcttgtcgg agcactgttc ggctttagca gcgtcttctg gctgatggcc       780
     aagttcttca gccagatggc agtggtgact ttcggcggtg cctacgccgt actggcttac       840
     gtggctcagg aggctgtgca ggtcttcggg tggctcaagc cgggcgaaat gctcaacggt       900
     ctgggcatgg cagaaacgac tcctggtccg ttgatccagg tggtgcagta cgtgggtttc       960
     atgggcgcct tccgggatcc tgagggcctg actccactgg ctgcaggcat cctggcatcg      1020
     gtggttgtta cctgggcaac ctacgctcct tgtttcctgt ggattttcct gggagctccg      1080
     tatatcgagc agttgcgtgg caacaaggcc ctgtctggcg ccttaaccgc tattacagcg      1140
     gcggtagtgg gcgtcatcct caatctcagt gtgtggtttg ctctcaatac cctgttctcc      1200
     agggtggggg agacgcacct gggacccctg cgcctgtaca caccggactg gagcaccctg      1260
     aatatccctt cgctggtact ggccgtcatc gcggggatcg ccctcttccg cttcaagctg      1320
     ggcgcaatcc ccacgctggc cctgaccacg gttcttggtg cggcttttgt cctcctgacc      1380
     cggagtgggg ggtga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page