(data stored in ACNUC7421 zone)

EMBL: CP001115.PE227

CP001115.PE227       Location/Qualifiers
FT   CDS_pept        complement(292347..292703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01731"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01731"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47626"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I7"
FT                   /protein_id="ACO47626.1"
FT                   /translation="MDDMYLGDVVKGFWRYASAMFLGWDWSGATLAVRLAASVVCVIPA
FT                   QLLSVISCPELTQQGPPDTSTFPGEGISLRKSGVEWPTSGVWTEPAHKISRRNTLARDY
FT                   GWGAFPVSLLCQAP"
     atggatgata tgtacctcgg agatgtggtg aaggggttct ggaggtacgc cagcgccatg        60
     ttcctgggtt gggactggtc tggggccacg ttggctgttc gactggctgc gtcggtagta       120
     tgtgtcatcc ctgcgcagct cctttctgtg atcagctgtc cagagctaac ccaacaaggc       180
     cctcccgaca cttcgacatt tccgggtgaa gggatatccc tgaggaagtc gggggtggag       240
     tggccaacct ccggcgtctg gactgagcct gcccacaaaa tctcccggcg gaatacgttg       300
     gctcgtgact acgggtgggg cgcgttccca gtatcactac tgtgccaggc gccctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page