(data stored in ACNUC7421 zone)

EMBL: CP001115.PE228

CP001115.PE228       Location/Qualifiers
FT   CDS_pept        complement(292759..293946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01732"
FT                   /product="conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01732"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47627"
FT                   /db_xref="InterPro:IPR021516"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I8"
FT                   /protein_id="ACO47627.1"
FT                   /translation="MLRILLAIAALSFSGASAQPEQVDTLRVQTQFASVPLTELRSGGP
FT                   PPNGIPPLGFQGDSQGFPDTKAAQFEPVKAAGSWLEPREPVILVTVAGETGIFPLQVLL
FT                   WHEIANVTLGRVPVAVTFCPLCNTALVADRRIPVGQEQLRRLKGNPQVKDGRVLVTFGV
FT                   SGLLYKSDLVMFDSATHSLWYQAMGRGIVGPLTGTQLRVYPSLIVSFAEAARDAPQARV
FT                   LSRRTGYTRDYGRNPYVGYDDVDEPPFLYSGPLDRRLAPKERVVTVSAGEAHTAYPFRT
FT                   LAQQRVVNDHIATIAIVVFWAPGTRSAMNTTSVNEGRDVGSGVVFSRRVGGRDLTFESR
FT                   NGTFRDRETGSTWSLTGRATDGPLRGTALKPFAHGNHFWFAWAAYVPRTEVYLPR"
     gtgctcagaa tactgcttgc cattgctgcc ctttcgttca gtggggcaag tgcacaacct        60
     gaacaggtag atactcttcg cgtccagaca caatttgcgt ctgttcccct gacggaattg       120
     cgttctgggg gcccgcctcc aaatggcatt ccgccgctgg gatttcaggg agactcgcaa       180
     ggctttcccg ataccaaggc ggcacagttc gaaccagtga aggcggccgg cagctggctg       240
     gagccacgtg aacccgtaat tcttgtaacg gttgctggcg aaacaggcat ttttccgcta       300
     caggtcctgt tatggcacga gattgcgaac gtgactctgg gcagggttcc tgtcgctgtg       360
     accttctgtc cgctgtgcaa cacggcattg gttgccgacc gcagaattcc ggtagggcag       420
     gagcagctgc gccgcctgaa aggaaacccc caggtcaaag atggccgcgt gctggtgact       480
     tttggtgtgt ctggtctgct gtacaaaagt gatcttgtaa tgttcgactc tgctacccat       540
     tcgctgtggt atcaggcgat gggtcgtggc attgtcggcc ccctcaccgg tacgcaattg       600
     cgggtctacc caagcctgat cgtgtcattt gcggaggccg cccgcgatgc gccgcaggca       660
     cgggtgctct ccaggcgaac cgggtatacc cgcgactacg gccgcaaccc ctatgtcggc       720
     tacgacgacg tggatgagcc tccgtttctg tactcggggc cgctggaccg tcgtctggcg       780
     cccaaggagc gggtcgtgac cgtcagtgca ggtgaagcgc atactgccta tccttttcgg       840
     accctggcac agcagcgcgt ggtgaatgac cacatcgcca ccatagccat tgtcgtgttc       900
     tgggctcctg gaacccgaag cgctatgaat acgacaagcg tgaacgaagg ccgtgacgtc       960
     ggctcagggg tcgtcttcag tcgtcgagtc ggaggacgtg atctgacgtt cgagagtaga      1020
     aacggcactt tccgtgaccg ggagacaggc agcacgtggt ccctgacggg acgtgccacc      1080
     gacgggccgc tgagaggcac cgccctgaag ccttttgccc atgggaatca tttctggttt      1140
     gcatgggctg cttacgtacc tcggacagaa gtttatctgc cgcgttga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page