(data stored in ACNUC7421 zone)

EMBL: CP001115.PE23

CP001115.PE23        Location/Qualifiers
FT   CDS_pept        33119..35323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00170"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47413"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1X4"
FT                   /protein_id="ACO47413.2"
FT                   /translation="MTSSRQPSRGMCRACGYVGTKASMTKHQAGCASRQAPGGTTHDVF
FT                   RCRISGADLPAYWLDVELTPKATLDDLDRFLRDIWLECCGHLSSFTIGPHDNGDFGSFR
FT                   ASRRTRQPSLAELDLHPGDKFGYTYDFGSSTNLTVQVQAYESVSGEATDRIKLLARNLP
FT                   PISVCSLCSKPAKWVHTWESDDATGGPLLYCGSHGKKTRDEQLPVVNSPRMGVCGYEGG
FT                   SDESWPPHPSKLTAEHSPSEAELPAHTTSQDTTPAGNRSLLEQDGLDEALLAYVETLPL
FT                   QTETVWLVAIQEMPAILPPEEGRAAVVLVVDAASGQILTSEVMTDITTQAVQEAVLETM
FT                   LAPEADDIKPQRPGQIFTLDAELAFSLHTTLAALGIRVERRDSPELEELLAHLRDEVGS
FT                   GMRALVEGQRPRAFLHGVPDVDVRNLIETFARFMKAKPWRNFAPDKPLRASWTNPDGTS
FT                   SQLYAMVLGGLGEVYGLALYPDWLSYNKHVLNSFHPELVLLATGGLESLTLSQREEIHP
FT                   EDWERLRTAGLPARAQAGPALIRIGLTGTQPPTFPLQPLTEVLRILSERAERKASPVTS
FT                   LKAELGGVSVKYPADPRDELSAQERSGSVQVRVRSNAGHFTYNAEVVMTGPPETLVRNA
FT                   FAQARRLLDQKPGEGRNVYLPYRLESAGQALENSGFFEDLHVLIWENRPGSPALTLAHL
FT                   ASMGPLIDGELATIEVAPQAADVAGLTVELQAVDPGSGVS"
     atgaccagtt cccgtcagcc gtcccgggga atgtgccgcg cctgtggtta cgtcggcact        60
     aaagccagca tgaccaaaca tcaagccggg tgtgcctcca ggcaggcacc aggcgggaca       120
     acccacgacg tgttccggtg ccgcatcagc ggagctgacc ttccagcgta ctggctggat       180
     gtcgaactga cgcccaaggc cactctggat gacctggacc gttttctgcg cgacatctgg       240
     ctggaatgct gcggtcacct gagcagcttc accatcggtc cgcacgacaa cggcgacttt       300
     ggctcgttca gagcatccag gcggaccagg cagccttcgc tggccgaact tgacctgcac       360
     cctggcgata agttcggtta cacctacgat ttcggcagca gtaccaacct gactgtgcag       420
     gttcaagctt acgagtcagt aagcggcgag gcgaccgaca ggatcaagtt gcttgcgcgg       480
     aacctgcctc caatcagcgt atgttctctc tgttcgaaac cggccaaatg ggtccacacc       540
     tgggagtctg acgacgccac aggtggcccg ctgttgtact gcggctcgca tggcaagaag       600
     acccgtgatg agcaattacc ggtcgtcaac tcaccgcgca tgggagtgtg cggctatgaa       660
     ggtgggagtg acgagagctg gccgccccat ccatcgaagc tgaccgccga gcactcaccc       720
     tcagaagcgg agctgccagc ccacaccacg agtcaggaca ccacgcccgc cgggaacagg       780
     agccttctgg aacaggatgg ccttgatgag gccttgctgg cctacgtcga gacgctgcca       840
     ttgcagactg aaacagtctg gctggtggcc attcaggaga tgcctgccat cctgcctcca       900
     gaagagggta gagcggcagt ggttctggtg gtcgatgctg cgagtgggca gatcttgacc       960
     agcgaggtga tgaccgacat cacgacgcag gcggtacagg aggcagtgct cgagacgatg      1020
     ctggcacctg aagcagatga tattaagccg caacgtcccg gccagatttt tactctggac      1080
     gcagagctgg cattctcgct gcacaccacg ctggcagcac tggggatcag ggtcgagcgg      1140
     cgggacagtc ccgagcttga ggaattgctc gcccacttaa gagatgaagt cggatccggg      1200
     atgcgggccc tggtcgaagg tcagcgtccg cgtgctttcc tgcacggcgt gcctgatgtg      1260
     gacgtcagga acctgataga aaccttcgcg cgcttcatga aggcaaaacc gtggcggaac      1320
     tttgctccag acaagccgtt gcgggcgagc tggaccaacc cagacggtac gtccagccag      1380
     ctgtacgcga tggtgctcgg cggcctgggt gaggtgtacg gcctggcgct gtatcccgac      1440
     tggttgagtt acaacaagca cgtcctcaat agctttcatc ccgaactggt gttgctagcc      1500
     accggcggct tggagagcct gacgttgagt cagcgggaag agattcaccc ggaagattgg      1560
     gagaggctgc ggacagctgg cttaccggcc cgtgctcaag ctggcccagc gctgatccga      1620
     atagggctga cagggactca accgccgacc tttcctctgc agcccctgac agaggtgttg      1680
     aggattctgt cagagcgtgc ggagcgaaaa gcgagccctg tgacgtcttt gaaagctgaa      1740
     ctcggcgggg tcagcgtgaa gtacccggcg gatccgcgcg atgagctgag cgctcaggag      1800
     cggagtggaa gtgttcaagt gcgggtgagg agcaatgctg gtcacttcac gtataacgca      1860
     gaggtcgtca tgaccggccc tccagagacg ctggtgagaa atgcctttgc ccaggcccga      1920
     cgtctcctgg atcagaagcc aggagaaggc agaaatgttt acctcccgta ccgcctggag      1980
     tctgctggtc aggctctaga gaacagcggt ttcttcgaag atttgcatgt tctgatctgg      2040
     gagaaccgcc cgggcagccc agcccttact ctggcgcacc tcgcgagcat gggcccactg      2100
     atcgacgggg aactcgcaac gattgaggtc gctcctcaag cggcggatgt tgcaggctta      2160
     acagtggagt tgcaggcggt tgatcccggg tcaggtgtgt cttga                      2205
//

If you have problems or comments...

PBIL Back to PBIL home page