(data stored in ACNUC7421 zone)

EMBL: CP001115.PE231

CP001115.PE231       Location/Qualifiers
FT   CDS_pept        296510..296881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01736"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01736"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47630"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2J1"
FT                   /protein_id="ACO47630.1"
FT                   /translation="MESVAIGLILLTLPPLLYIVSQKTGVRYTWTPDALQVDTGLRRYI
FT                   FPYATTTARLTTQPLGSRIWGTAVSGSVTGRYTLDSSTVQALATTARPAQALLLEAGQQ
FT                   TFYVTPERAEEFAARFLAK"
     atggagtccg tggctattgg cttgattctg ctcaccctcc ccccgctgct ctacatcgtc        60
     agtcagaaga ccggagtgag gtacacctgg acgccggatg ccctccaggt ggataccggc       120
     ttgcgaagat acatctttcc atatgcgacg acgacggccc gtctcaccac gcaacccctg       180
     ggctcccgga tctggggcac agcagtatcc gggagtgtga cgggccgtta taccctggac       240
     agcagcactg ttcaggcctt agctacgacc gctcgcccag cacaggccct gcttctagag       300
     gctggtcagc aaacgttcta tgtcacgcca gagagggctg aggagttcgc ggcgcgattt       360
     ttagcgaaat ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page