(data stored in ACNUC7421 zone)

EMBL: CP001115.PE233

CP001115.PE233       Location/Qualifiers
FT   CDS_pept        297942..298355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01738"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01738"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47632"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2J3"
FT                   /protein_id="ACO47632.1"
FT                   /translation="MRQQDSRTDDHQTQFANALKQLMVAHGLGSVRARGDSGFLGLTPA
FT                   GKFETTDLAFKFMAPDEHLAAAQALGLPAPQIGPSGRSARPQDMERFVRATGQLFDEYG
FT                   VMNLEFTREALLGFRKTGHTVDFVVEGITLTLR"
     atgcgccagc aggattccag gacagacgat caccagactc aattcgccaa tgcgttgaaa        60
     cagcttatgg tggcgcatgg cctcggttca gtacgggcaa gaggagactc tggtttcctg       120
     ggcctgactc cagcgggaaa attcgaaacg accgacctgg ctttcaagtt tatggcacca       180
     gacgaacatc tggcggcagc tcaggcgctg ggattgccag cgccgcaaat cgggcccagc       240
     gggagatcag caagacctca agacatggag cgtttcgtcc gagctaccgg ccagctcttt       300
     gacgaatacg gcgtgatgaa tctggagttc acccgagaag cacttctggg attcagaaag       360
     actggccata cggttgattt tgtagtggaa ggcatcacgc tgaccctccg gtag             414
//

If you have problems or comments...

PBIL Back to PBIL home page