(data stored in ACNUC7421 zone)

EMBL: CP001115.PE234

CP001115.PE234       Location/Qualifiers
FT   CDS_pept        298849..300375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01751"
FT                   /product="putative Diguanylate cyclase (GGDEF domain) with
FT                   GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01751"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47633"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2J4"
FT                   /protein_id="ACO47633.1"
FT                   /translation="MPSAPLPEQEYARLLELARYNILDTAPEESFDRLTRLAARTLRVP
FT                   GVILNFVDQGRQWRKSWFGDGETNCSREDSFCAWTILSDDVLAVSDAREDPRFHDYKLV
FT                   VGDPNIRMYAGAPLVTPSGHRIGSLCVFSAEARELDLDDQATLRDLAALVMDELELRLH
FT                   NHVLQSQINQQDQQLWELRQTVAHAQVLEDINGLTETATTPEEVTLAVAAKIGEAIHAD
FT                   WTGLIAFSGNDATIQVAHHQPDLSPALLAFASRLPQLPCGVTRGMRGVTHTAYIEDYRQ
FT                   HPDALQEGVDAGFKSAALVPLGQYGEIEFLLIAARAERGSRAAWRSSDRALLDAAGRTV
FT                   RAALVRRAALEASLLAARQDRLTGIANRRAFDHDLELRMQAGQPFTFALMDLDGFKQVN
FT                   DVEGHAQGDRVLQVFALALRDTVSSYGQVYRYGGDEFALLLDPLTDERALEHVDSAVLA
FT                   ARQVTTRFVGASVGIVQMGNEDNPYCPSELQQRADTRMYEVKRRRQAALN"
     atgccgagcg cgcctctacc agaacaggaa tatgcacgtc tcctggaact cgctcgatac        60
     aacattctcg acactgcacc tgaagagagc tttgatcgtc tgacccggct cgcggcccgt       120
     actttgcgtg tgcctggagt catcctgaac tttgtggatc agggacggca gtggaggaaa       180
     tcctggtttg gagacgggga gaccaactgc tcgcgggaag actcgttctg cgcctggacc       240
     atcctgtctg acgacgtgct ggccgtgtca gacgccaggg aagacccccg gtttcacgat       300
     tataagctgg tggtcggaga tccgaacata cgtatgtacg ctggagcgcc attggttacg       360
     ccatcggggc accgcattgg ttcactgtgt gtcttcagcg cggaggcacg agaacttgac       420
     ctggatgatc aggcaacgct gcgtgatctg gctgcacttg tgatggatga actggaactc       480
     cggctgcata atcatgtcct tcagtcgcag attaaccagc aggatcagca gctttgggaa       540
     ttgcggcaaa cggtcgccca cgctcaggtg ctggaagata ttaatggcct gaccgagact       600
     gcgacgaccc ctgaggaagt gactctggcg gtggctgcca agatcggcga agcaatccat       660
     gcggactgga ctggattgat cgccttctct ggcaacgacg cgaccataca ggtcgcccac       720
     catcagcctg atctcagtcc ggctctgctg gcctttgcct ctcgtttacc gcaacttccg       780
     tgtggtgtca cccggggcat gcgtggtgta acgcatacag cgtacataga ggattaccgg       840
     cagcatccag acgctctgca agaaggtgta gacgctggct ttaaatcagc tgccctggtc       900
     cccctgggtc aatatggcga gattgagttt ctgctgattg cagcccgcgc cgagcgaggg       960
     agtcgtgctg cgtggcgtag cagtgaccgg gccttgctgg atgctgccgg caggaccgta      1020
     cgagctgccc tggtacgccg ggcagccctg gaagccagtc tgctggctgc ccgacaggac      1080
     cgtctgacgg gaattgccaa ccgccgggct ttcgatcacg atcttgagct gcggatgcag      1140
     gcaggacagc cttttacgtt cgccttgatg gatcttgacg ggttcaagca ggtgaacgac      1200
     gttgaggggc acgcacaggg cgaccgcgtt ctccaggtgt ttgccttggc tctccgtgac      1260
     acggtcagca gttatgggca agtctaccgc tatggtggtg acgagttcgc cctgcttctg      1320
     gatcctctca ccgacgagag ggcactggaa catgtagaca gcgcagtact tgcggcgcgg      1380
     caggtgacca cccggtttgt gggggccagc gtcggtattg tgcagatggg aaacgaggac      1440
     aacccgtact gtccgtctga gctgcaacag cgcgctgata cccggatgta tgaagtgaaa      1500
     aggcgccgac aggctgccct gaactga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page