(data stored in ACNUC7421 zone)

EMBL: CP001115.PE235

CP001115.PE235       Location/Qualifiers
FT   CDS_pept        complement(300642..300974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01752"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01752"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47634"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2J5"
FT                   /protein_id="ACO47634.2"
FT                   /translation="MDLPAAKQVVQQIINDLSLPDGTRLGVDVDANPDRLNIIAISGRR
FT                   AGVVVITKEALEDHGHKAINAAIERLRRAIYDKDLPLLTGAPVQLGMLDSRGWTDGSVS
FT                   PYSNDS"
     atggatcttc cggcagcaaa acaggtggtg caacaaataa tcaacgatct gtctcttcca        60
     gacggcactc gtctgggggt tgacgtggat gccaatccag accgtctgaa tatcattgcg       120
     atcagcggcc gacgtgctgg agtggttgtt atcacaaaag aggcgttaga agaccatggc       180
     cacaaagcca tcaacgctgc catcgaacgc ctgcgcaggg caatctacga caaagacctc       240
     cccctgttga caggagcgcc tgttcaactg ggtatgctgg attcacgagg ctggaccgat       300
     ggctctgtct ctccctactc aaacgattcc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page