(data stored in ACNUC7421 zone)

EMBL: CP001115.PE239

CP001115.PE239       Location/Qualifiers
FT   CDS_pept        307377..308738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01800"
FT                   /product="putative plasmid replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47639"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K0"
FT                   /protein_id="ACO47639.1"
FT                   /translation="MTSPPSRFDELNLSRLNLISAVDQAEVSEWDVTFEAHGRIVHVRC
FT                   EALPKYAVPHGLDSDVTAALINLYIELGEPEDGRFSVSATTLLKLCGWHNTGKYHGILR
FT                   VCLERLHTSSYSVSGGWRDHPKGRWTHAKFHFIESLDFSSSDGAGAFDDRTIIAGRLAD
FT                   VIVASIRSGYVKPLDTEFMLSLSRPRTRALYRILDGARYDPDHPDVRLDTLEFNLIQWA
FT                   DQCKIPSTIPGNIRRALASPHEELIKRGYLRAATLSGRGKDQRVRYEFVREFVAMDAVL
FT                   ARRFRSYGVADGVARKLLVEHGRDALIASMDRFDGLVRQGVLVVKKTPAAALMHLINHP
FT                   DDYPYPKGAPAAPAPVRPARVEPVMEAPSVEAEFASLSLEQAAERLISRMNVHYRKLLS
FT                   VSDLDTLRQAVMKELLSPSAVLEEATAAVVKLQRENFAQTLRARLGLPEERPIK"
     gtgacgtcgc ccccatcccg cttcgacgaa ctcaatctgt cacgtctgaa ccttatttcc        60
     gccgtggacc aggctgaagt cagtgaatgg gatgtcacct tcgaggcaca tggccggatc       120
     gtccacgtgc gctgcgaagc tctgccgaaa tacgcggttc cgcacgggct cgacagcgac       180
     gtcacggcgg cactgatcaa cctgtatatc gaactcggcg aaccagaaga cggccgtttc       240
     tcggtcagtg ccacaacgct actgaaatta tgcggctggc acaatacggg caagtaccac       300
     ggcattctca gggtctgcct cgagcgtctg cacacgtcct cgtatagcgt ttcgggcggc       360
     tggcgggacc atcccaaggg acgctggacc cacgcgaaat tccattttat cgagtcgctg       420
     gacttcagca gctcagatgg tgccggcgcc ttcgacgacc ggactatcat tgctggtcgg       480
     cttgcggacg tcatcgtggc cagcatccgc tcgggttacg tcaaaccact ggacaccgag       540
     ttcatgcttt ccctgtcgcg tccgcgaacc cgggccctgt accggattct cgacggcgcg       600
     cgctacgacc cggatcatcc agacgtgcgc ctggataccc tggagttcaa tctcatccag       660
     tgggccgatc agtgcaagat tcccagcacc atacccggca acatccggcg cgccctcgcc       720
     tcgccgcatg aggagttgat caaacgcggg tacctgcgag ccgccaccct ctccggccgt       780
     ggcaaggacc agcgtgttcg ttacgagttc gtccgggagt tcgtagcgat ggacgcggtg       840
     cttgctcggc ggttccgctc ctacggggtc gcggacggcg tcgcccgcaa actgctggtg       900
     gaacacggcc gggacgcgct gatcgcgtca atggaccgct tcgacggatt ggttcgtcag       960
     ggtgtcctgg tcgtaaagaa gacaccagcc gcggcgctga tgcacctgat caatcatcca      1020
     gatgactacc cctatccgaa aggcgctccc gctgcgcctg ctcctgtccg tccggctcgc      1080
     gtggagcctg ttatggaagc tccaagtgtg gaggccgagt ttgcgtctct cagcctggag      1140
     caggctgctg aacgcctgat ttccaggatg aacgtgcatt accgcaaact gctgagtgtt      1200
     tcagatctcg acaccttgcg ccaggccgtc atgaaggagc tcctttcacc ttcagcggtg      1260
     ctggaagagg ctactgccgc cgtggtcaag ctgcagcgtg agaactttgc ccagaccttg      1320
     agagcacggc ttggactgcc tgaggagagg cccataaaat ag                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page