(data stored in ACNUC7421 zone)

EMBL: CP001115.PE241

CP001115.PE241       Location/Qualifiers
FT   CDS_pept        complement(311564..311872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01811"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01811"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47641"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K2"
FT                   /protein_id="ACO47641.1"
FT                   /translation="MEYVLVKIRHDRDAGRGRVLSSECLTIDEGTTVRIVKHEASGGQL
FT                   CHYELLDEETGLMYTAECGTGEGRYDDVYTYRVQEPGIRVGSQSMGQVMGTKTSGTR"
     atggaatatg tgctagtgaa gattcggcat gatcgtgatg ctggtcgcgg ccgggtgctg        60
     tcatccgagt gcctgaccat agacgagggc accaccgtcc ggattgtgaa gcacgaagcc       120
     tctggtgggc agctctgcca ctatgaactt ctggatgagg agaccggcct catgtatacg       180
     gcagagtgtg gcacgggaga aggccggtat gacgatgtct acacctacag ggtgcaggaa       240
     ccggggatcc gggtcggcag tcagagcatg ggtcaggtta tggggacaaa aacatcagga       300
     acccggtag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page