(data stored in ACNUC7421 zone)

EMBL: CP001115.PE242

CP001115.PE242       Location/Qualifiers
FT   CDS_pept        complement(312054..312938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01820"
FT                   /product="putative transglutaminase/protease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47642"
FT                   /db_xref="GOA:C1D2K3"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K3"
FT                   /protein_id="ACO47642.1"
FT                   /translation="MSSDECSDVIHVRVGFHLTFDLPFTTPMLFVVEPQNRPGQQIVQT
FT                   REYLDPSAGVGRWSRYTDVFGNSIWRVLGVGHTLQVGQDVIVQVPAHSDPQHPDLPKTP
FT                   VEDLPDEVLQFLLPSRYVDSDLISNEAWERFGHIQGGWAQVQAISHHLYSTCSYGAAST
FT                   SSTTAQQAYQSGRAVCRDFAHMGVAFCRALNIPARYVCGYLGDIGVPSTDTPMDFHAWF
FT                   EAWIDGAWRTFDARHNKPRTGRVLIATGRDAADVAFTTSFGAARLTRMQVWADQVDPGF
FT                   TLPDTWAPPQPRA"
     atgtcttctg acgagtgctc cgacgtgatt catgtccggg tcggctttca ccttactttt        60
     gacctgccgt tcaccacccc gatgctgttc gtggtggaac cacagaatcg gccgggtcag       120
     caaatcgtgc agacccgtga atacctggac ccgtcagccg gcgtggggcg ctggagccgg       180
     tataccgacg tcttcggcaa ctcgatctgg cgggtcctgg gggtaggcca cacactgcag       240
     gtcggacagg acgtcatcgt gcaggtgccg gcccacagtg atccacagca ccctgacctt       300
     ccgaagacgc ctgtagagga tctgcctgac gaagtgctgc agtttttact cccaagccgg       360
     tatgtggact ctgacctgat ttccaacgag gcctgggagc gcttcgggca catccagggt       420
     gggtgggcgc aggtccaggc aataagtcac cacctttaca gcacctgcag ctatggagca       480
     gccagtacgt cgagcaccac cgcgcagcag gcgtaccaga gcggccgcgc cgtatgccgg       540
     gactttgccc acatgggcgt ggcgttctgc cgggcgctca atattcctgc ccgctacgtc       600
     tgcggctacc tgggcgacat tggcgtcccg agcacagata cgcccatgga ctttcatgcc       660
     tggtttgagg cctggatcga cggtgcctgg cggacctttg acgcccggca caacaaaccc       720
     agaacaggtc gggtgctgat cgccactgga cgggacgctg cagacgttgc cttcaccacc       780
     agcttcggtg ccgcccggct gacccggatg caggtgtggg cagatcaggt agacccgggc       840
     ttcaccctgc cagatacgtg ggcgccgcct cagcccaggg cataa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page