(data stored in ACNUC7421 zone)

EMBL: CP001115.PE243

CP001115.PE243       Location/Qualifiers
FT   CDS_pept        313245..315047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47643"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K4"
FT                   /protein_id="ACO47643.1"
FT                   /translation="MEQYDQGTTFFDEMFTPQGQVRPHYQGVLSYFRRLGTTEFQRRQA
FT                   LMDLAFRNQGITFTVYGDSAGVERTFPFDPVPRIIPASEWSALEAGLKQRVKALNAFLR
FT                   DVYSDGQILKDGIIPRELVYTSSNFRREVHGLQVPLGIYTHIVGSDLIRDEQGRYLVLE
FT                   DNLRSPSGVSYLLANRQAMTRIFPGMFERQGVRTVDHYTTALLGVLSSLSPRAPEATVV
FT                   VLTPGMYNSAYFEHAYLAQQMGVELVEGRDLFVDGGRVWMRTTSGRTQVDVIYRRIDDD
FT                   FLDPLTFRRDSALGVPGLVEVYRQGRVAIANAIGAGVADDKAVYAYVPRMIEYYLGEQP
FT                   LLDNVPTFLGWNPDHLAYMLDNAAELVIKAVGEAGGYGMLIGPAATREETEDFLKNVRA
FT                   NPRNYIAQPVIGLSRHPTFYPDARAFEPAHVDLRPYILVGQEVTIVPGGLTRVALRRGS
FT                   LVVNSSQGGGSKDTWVLNHDGPAPARIQQQFQGATEPQEPHPAVPGEVKVEAQAGHTQV
FT                   QSLGRMMQEQSLGGAQAHSRSPSLVQEEDPQSSTAGQHQWQGAAGEPLSAEERDEAGAP
FT                   DSGVSDMLTSGQSGPGPADPKGDI"
     atggagcagt acgaccaggg gacgacattt ttcgacgaga tgtttacccc gcaggggcag        60
     gtcaggccgc attaccaggg cgtgctgtca tacttccggc gcctgggcac aacggagttt       120
     cagcgccggc aggcactgat ggatctggcc ttccgcaatc agggcattac attcaccgtg       180
     tacggcgaca gtgccggggt cgagcggact tttcccttcg acccggtccc gcgcattatc       240
     cctgcctcag agtggagtgc cctcgaagcg ggcctcaagc agcgtgtcaa ggcactgaac       300
     gcttttttgc gtgacgtcta cagcgacggc cagattctga aagacgggat tattccccgc       360
     gagctggtct acacttccag caactttcgc cgtgaggtcc acggccttca ggtcccgctg       420
     ggcatttaca cccacattgt cggcagcgac ctgatccgtg acgagcaggg ccgctacctg       480
     gtgctggagg acaacctgcg ttcgcccagc ggtgtcagct acctgctggc caaccgtcag       540
     gcgatgaccc gtattttccc tggcatgttc gagcgccagg gggtgcgcac cgtggaccac       600
     tacaccacag ccctgttggg ggtgctgagt tccctgagcc cgcgtgcgcc tgaggcgact       660
     gtggtggtcc tgaccccagg gatgtacaac agcgcctact tcgagcacgc ctacctcgcc       720
     cagcagatgg gcgtggaact ggtcgagggc cgcgacctgt tcgtggatgg cggccgggta       780
     tggatgcgca cgacctcggg ccggacgcag gttgacgtga tctaccgccg gattgacgat       840
     gacttcctgg atcccctgac cttccgccgc gattctgcgc tgggtgttcc tggtctggta       900
     gaggtgtacc gtcaggggcg ggtagcgatt gccaatgcaa tcggcgccgg ggtggcggat       960
     gacaaggctg tctatgccta cgtgccgcgc atgatcgagt actacctggg cgaacagccc      1020
     ctgctggaca atgttcccac ctttctggga tggaaccccg accatctggc gtacatgctg      1080
     gacaatgccg ccgagctcgt gatcaaggcc gtgggcgagg ccggagggta cggcatgctg      1140
     attggtccgg cggcgacccg ggaagagacc gaggactttc tcaagaacgt ccgcgccaat      1200
     ccccgcaatt acattgccca gccggtgatc ggtctttcgc ggcatccgac cttctacccg      1260
     gatgccaggg cctttgaacc cgctcacgtg gatctccggc cctacatcct ggtggggcag      1320
     gaggtcacga tcgtgcctgg aggcctcacc cgggttgcgc tgcggcgcgg gtcgctggtg      1380
     gtcaattcct ctcagggcgg gggcagcaag gacacctggg tcctgaatca cgacggtccg      1440
     gctcctgcgc ggattcagca gcagtttcag ggtgccaccg aacctcagga gccgcatcct      1500
     gcggtgccag gcgaggtcaa ggtagaggcc caggcaggac acacgcaggt acagagcctg      1560
     ggcaggatga tgcaggagca gtctctgggc ggagcgcagg cacactcccg aagtccatct      1620
     ctggttcagg aagaagaccc gcagtccagc accgccgggc agcaccaatg gcagggggcg      1680
     gctggtgagc ctctgtctgc cgaggagcga gacgaggctg gggcgccgga ttccggcgtg      1740
     agcgacatgc tgacgtccgg ccagtccggc cctgggcccg ctgacccgaa aggagacatc      1800
     tga                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page