(data stored in ACNUC7421 zone)

EMBL: CP001115.PE245

CP001115.PE245       Location/Qualifiers
FT   CDS_pept        316007..316852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01850"
FT                   /product="putative transglutaminase/protease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47645"
FT                   /db_xref="GOA:C1D2K6"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K6"
FT                   /protein_id="ACO47645.1"
FT                   /translation="MRADIRHITEYRYAEPAWDSFNEVRLSPEVSARQDLRSFHLAVRP
FT                   EPSLVSTHRDYFGSLIHHVHVHEPHQVLRIEAQALVITRPLPGLETVPFSALDELRGEV
FT                   TEFLVSSPRVPSGRWPEVFGVRAPQPHEDLSAFMVALTTQLHRQFTYHPGATSVSTTLE
FT                   QFARDLRGVCQDYTHAMLGICRTLGIPARYVSGYLYSGGEMIGADATHAWVEVLIPGQG
FT                   WVGFDPTNDMLAGEKHIKIGHGRDYPDVSPVRGTYYGGGGEASLNVEVRVYGDPPARQE
FT                   "
     atgcgcgccg atatccgcca catcaccgag taccgttatg cggagcccgc ctgggattcg        60
     tttaatgagg tgcggctgtc tcctgaggtc agcgcccgcc aggatctccg gagctttcac       120
     ctggcagtgc ggccagagcc cagcctggtc tccactcacc gcgactactt cgggtctctg       180
     atacatcacg tgcacgtgca tgagcctcat caggtgctgc gcatcgaggc gcaggcgctg       240
     gtgattacgc gtccactgcc aggtctggag acggtacctt tttcggccct ggacgaactg       300
     cgcggcgaag tcaccgagtt tctggtgtcc agcccacggg ttccgtcggg ccgctggcca       360
     gaggtttttg gcgtgcgggc tccgcagccg catgaggacc tgagcgcttt tatggtggct       420
     ctgaccaccc agctgcaccg gcagttcacc taccatccag gagcgaccag cgtcagcacg       480
     acgctcgagc agtttgccag ggacctgcgg ggcgtgtgcc aggactacac gcacgcgatg       540
     ctcggcatct gccggaccct ggggattccg gcgcggtatg tcagcggtta cctctactcc       600
     ggcggcgaga tgatcggcgc tgacgccacc catgcctggg tcgaagtcct gattccaggt       660
     cagggctggg tcggatttga ccccaccaac gacatgctgg ccggcgagaa gcacatcaaa       720
     attggccacg gccgtgatta ccctgacgtg tctcctgtgc gcgggaccta ctacggcggc       780
     ggcggggaag cctcactcaa tgtcgaggta cgggtgtatg gtgacccacc agccaggcag       840
     gaatga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page