(data stored in ACNUC7421 zone)

EMBL: CP001115.PE250

CP001115.PE250       Location/Qualifiers
FT   CDS_pept        319695..322871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01900"
FT                   /product="putative DNA polymerase III alpha subunit;
FT                   putative Error-prone DNA polymerase dnaE2"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47650"
FT                   /db_xref="GOA:C1D2L1"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2L1"
FT                   /protein_id="ACO47650.1"
FT                   /translation="MAGQSAGLGVPRLQVLLACQSYFSEGRSTVSPRRLVQRAADAGYS
FT                   AVGLADWCSVAGAVELGEAARAAGLAALVGVTLPVLFPAPPRSPAPYEPYPVVLLARDR
FT                   PGYAVLCRLITDVQGQYPGGLPLSLLQETGRQFQDHLLCLTGGRTGFPTVLGEQREVAR
FT                   AAFYLRTLRGIFPFSLYVQLYHGAAPNERRRLEYLRGLARDLELPVVAAPEVCMADAAD
FT                   YCLLDALTCARLGIDVQTPHPDRPRNDARHVGTPEEWGHLLPFPDALLNAERIADWCTF
FT                   ELLPERLRSPEPRLRPFQTAQEVLEERVFAAVGSRYSPGAREAALRRLKDELATVAHLD
FT                   LAGFFLTAAEVTDYCREHGILAAGRGSAAGSVLCYLLGITLSDPIEHNLLFERFLHTGR
FT                   TSMPDVDIDIASARRDQVLRWVEERWGLSGAGEAMVANRITYRMKSAIQDLGRALGMPP
FT                   DLRDRLSRALGRDYGHLRPHRAREAEVAFTEVLGDAPVKEALLCLLERIEPGFVRHLAP
FT                   HSGGVVLSSEPLTFYSPLTRSSGGIRMLTFDKDDVEKLGLIKLDLLGLRMLAALERARE
FT                   EVLRLTNEWVPYGELPDDPRVWAEISSGDTMGLFQIESPAQVQMTARLQPKTMTQLAHQ
FT                   VALVRPGPIQSGTVHPYVRRARGEEPVPERPEPLQSILRATHGTLMFQEQILRIAVHYA
FT                   GYDWPHADRFRSRLSKVEDGHELAELKEQFLSGAALTCGAFPWEAEEVFEMCAMFRGYG
FT                   FAESHAHAFAQHSYASAYMRHHYPAAYFAAFLTEAPGMWPANTIAQECRRRGVTLLPVC
FT                   INRSGLSYRAESLRTIRVPLTAVEGISEAKAREIVHERLIGGKFSTLEDAYDRIDLSRD
FT                   RFEKLVLAGGLTSIEPSRRKGLFGLTLLANARKAGTRPLLAPGIEPPELPEMSSTEYLA
FT                   LDLRTKGLSETGRHPLDAHRARLRDLGCQALGGLNHGDTAWVAGVIVARQRPPTAKGFA
FT                   FYVLEDRTARLQAIISPDLWEANRVLLRDARALIVCGPVTRLGQAITIKVQRLSELPLR
FT                   WPEPDVEAAD"
     gtggctggcc agagtgcagg actaggtgtg ccgcggctgc aggtcctgct cgcatgtcag        60
     tcgtacttca gtgagggccg aagcaccgtg agtcccagac gtctggtcca gcgggcagca       120
     gacgccgggt attcggccgt gggactggcg gactggtgca gtgtcgctgg agccgtggag       180
     cttggcgagg ccgctcgggc agctggtctg gcggcacttg tcggcgtgac gctgccggtg       240
     ctcttccctg ccccgccgcg ttcgcccgcg ccatatgagc cctacccggt ggtgctcctc       300
     gcgcgtgacc gcccggggta cgcggtcctg tgccgtttga tcacggacgt acagggtcaa       360
     tatccgggcg ggcttccact gtcactcctg caggaaacgg gacggcagtt ccaggaccat       420
     ctgctgtgtc tgacgggtgg gcgcacagga ttcccgacgg tcctcggcga gcagcgggag       480
     gtcgcgcggg ccgcgttcta tctccggaca ctgcggggaa tctttccctt cagcctgtac       540
     gtgcagctgt atcacggagc agcaccgaat gaacggcggc ggctggagta cctgcgcggc       600
     ctggcccgcg acctggaact gccggtggtg gctgctccgg aagtctgtat ggcagacgcg       660
     gcggactatt gcctgctcga cgcgctgacc tgcgcgcggc tgggcattga tgtgcagacc       720
     ccgcatccgg accggccccg caatgacgca cggcatgtcg gtactcctga agaatgggga       780
     catctgctgc ccttcccgga cgccctattg aatgcagagc ggatcgcaga ctggtgcacc       840
     ttcgagctgc tgcctgaacg gctgcgcagt cccgagccca gactccggcc ctttcagacg       900
     gcgcaggaag tactggagga gcgtgtgttc gcggcggtgg gttccagata ctcgccgggc       960
     gcacgggagg ctgccctgcg ccgcctgaaa gatgagctgg ccacggtcgc gcacctggac      1020
     ctggcaggct ttttcctgac ggcagcagaa gttaccgact actgccggga gcacggcatt      1080
     ctggcggctg ggcggggttc agcggctggg tcggtgctgt gttacctgct gggcatcacc      1140
     ctgtctgatc ccattgagca caacctgctg tttgagcgtt tcctgcatac cggccgcacc      1200
     agcatgccgg acgtggatat cgacatcgcc agtgcccggc gggatcaggt gctgcgctgg      1260
     gtcgaagaac gttgggggct gtctggtgca ggggaagcga tggtggccaa ccgaatcacg      1320
     taccgcatga aaagcgccat ccaggacctt gggcgcgccc tgggaatgcc tccagacctg      1380
     agagaccggc tgagccgtgc gctggggcgg gattacgggc acctgcgccc ccacagggcg      1440
     agagaagcgg aggtggcctt tacggaagtg cttggtgacg caccggtcaa ggaagcactg      1500
     ctctgcttgc tggaacgcat tgagccaggc ttcgtgcgcc acctggcgcc gcactccggg      1560
     ggggtggtgc tgagcagtga accactgacg ttctactctc ctctgacccg gtccagtggg      1620
     ggcatccgga tgctgacgtt tgacaaggac gacgtggaga aacttgggtt gatcaaactc      1680
     gacctgctgg ggctgcgaat gctcgcggcc ctggagcgcg ccagagagga ggtgctgcgc      1740
     ctcacgaacg agtgggtgcc gtacggtgag ttgccggacg acccgcgcgt gtgggccgag      1800
     atcagcagcg gggacaccat ggggcttttt cagattgaaa gcccggctca ggtgcagatg      1860
     accgcgcgac ttcagccgaa aaccatgacg cagctggccc atcaggtggc cctggtgcgt      1920
     ccaggaccca tccagtcggg caccgtacac ccatatgtcc ggcgtgcacg gggtgaagaa      1980
     ccggtaccgg aacgtccgga gcctttgcaa agcattctca gggcaactca cggcacgctg      2040
     atgtttcagg agcagatcct gcgtattgcg gtccattacg ccggatacga ctggccgcac      2100
     gcagaccggt tccgctccag gctgagcaag gtcgaagacg ggcacgagct ggcagagctg      2160
     aaagaacagt tcctgagtgg cgcagcgctg acgtgcgggg cgttcccctg ggaggcagag      2220
     gaagtgttcg agatgtgcgc gatgttccgt ggatacggct ttgccgagtc gcacgcccac      2280
     gcatttgcgc agcacagtta tgccagcgcg tacatgcggc accactaccc ggcggcgtac      2340
     ttcgctgcct tcttgaccga ggctcctgga atgtggccgg caaacaccat cgctcaggaa      2400
     tgccgccggc ggggtgtgac ccttcttccc gtctgtatca accgaagtgg tttgagctac      2460
     cgggccgaga gtctgcggac catccgggtg cccttgacgg ctgttgaggg gatcagtgaa      2520
     gccaaagcgc gggaaatcgt gcacgagcgc ctgataggtg gaaagttcag caccctggaa      2580
     gacgcatacg accggattga cctgtcacgg gaccgctttg agaagctggt gctggctggt      2640
     ggcctgacaa gtatcgagcc cagccggaga aagggtctgt ttggactgac gctcctggca      2700
     aatgcccgga aggctggaac gcggcctctg ttggcacccg gcatcgagcc acctgaactg      2760
     ccggaaatga gcagcaccga atacctcgcc ctggacctcc ggacgaaagg actgagcgaa      2820
     acgggacggc accccctgga cgcgcaccgg gcgcggctga gggacctggg atgccaggcg      2880
     ctcggcggtt tgaaccatgg agacacagcc tgggtagccg gggtcattgt ggccagacag      2940
     cggccgccca cagccaaggg cttcgcgttt tacgttcttg aagaccgcac agcacgcctg      3000
     caggccatca tcagcccgga tttgtgggag gccaaccggg tactgctgcg ggacgcgcgt      3060
     gcgcttatcg tgtgcggtcc ggtcacccgt ctgggacagg caatcacgat caaagttcag      3120
     cgcttgagtg agttgcctct tcggtggcca gagcctgacg ttgaggcggc ggactga         3177
//

If you have problems or comments...

PBIL Back to PBIL home page