(data stored in ACNUC7421 zone)

EMBL: CP001115.PE251

CP001115.PE251       Location/Qualifiers
FT   CDS_pept        322985..323425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01905"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26557"
FT                   /db_xref="UniProtKB/TrEMBL:X5HN84"
FT                   /protein_id="AHX26557.1"
FT                   /translation="MSDRQPPNKSSAHGNTASFRCETGPETLFDRVRFKMAGARRLKFY
FT                   SAQFRRRLVEEGVPMEELQQFDPEHWDLIAADVRTDTGKFINSTWVCSADQRRWRVVIG
FT                   FKDTIERVTGLEKDAPTPDAVTSGTLYKKVAKVNGELMDAEA"
     atgtcggacc gccaaccacc gaacaaaagc tcagcacatg gcaacactgc ctcctttcgt        60
     tgtgagactg ggccagaaac gttgttcgac cgggtgcgtt tcaaaatggc tggagcccga       120
     aggctgaagt tctactccgc acaatttcgc cgccgcctgg ttgaagaggg tgttcccatg       180
     gaggagctgc agcagttcga ccctgagcac tgggacctga tcgcagccga cgtccgtacc       240
     gataccggaa agtttatcaa ttcaacctgg gtgtgttcag ctgatcagag gcgctggcgg       300
     gtcgtcatcg gcttcaaaga cacgatagaa agggttactg gcctggagaa ggatgctccg       360
     actcccgacg ccgtgacctc cggcacgctt tacaaaaaag ttgccaaggt gaatggtgaa       420
     ctcatggacg ccgaggccta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page