(data stored in ACNUC7421 zone)

EMBL: CP001115.PE26

CP001115.PE26        Location/Qualifiers
FT   CDS_pept        complement(38451..41249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00200"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47416"
FT                   /db_xref="GOA:C1D1X7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1X7"
FT                   /protein_id="ACO47416.1"
FT                   /translation="MTVSNSQGNDLLTSDLLSVALDAFIGIDQHGRVIEWNPAAERTFG
FT                   YTRQEALGQAMNELIIPPAFQAAHQHGMARYLETGLAKVLYQRLRLEAQRRDGEIFPCE
FT                   LVIHEVQIQGARSFIASLRDLTEQVRAETALRKREADHRTLIENTAVGVARVDIEGRWL
FT                   EVNPAIERFLGYSEAELRGLTFRDVSHPDDLSQHNVGLFSRLVNGEGGTFTLEKRYIRK
FT                   DGVVVWGSVTVSPVVDPVTGYRSTVAVIHDITDRKRAEEYTERLHRVTADLARALTPEA
FT                   VLDVTLAEVMPAMGAAAGGALLIDDSEDYLEALGHAGYSEEMERRFSRVPLTMSLPVTD
FT                   TARTGEPYFLTSQELLERYPHLAGQREQFRSGAGLPLRVGDQITGVLVLSFSDDRLFSG
FT                   ADQTFMTSVADQCAQAIERARLYEVSRISVQRYRSLVETTSRIVWTRSPEGTFDHDQPQ
FT                   WTAFTGQRSPELLGMGWLDAVHPEDRARTADSWQNAVSSGTPYETKYRLRRADGMFRHM
FT                   HVRAIPLRDDDGTLREWIGVHTDITERLEAELALRESQGRLRFALEAAQLGDWEMSLHD
FT                   HSFRQSPRHDEIFGYPQGRPHWTYETFLEHVLPEDREDVNRKFTWAMEQEEAWDIECRI
FT                   RRADGEVRWIWTRGQAQKQPHGRARHMLGIVGDITVLKRAEAEVRALNVTLEQRVRERT
FT                   QELERSNRDLEQFAYVASHDLQEPLRTVTSYTELLARRYGGQLDEKAEKYMTFTVAAAR
FT                   RMGQLVQDLLDFSRVRAENHQVSRLDPNEVMVTLIRDLEETIEANGAAVSWDNLPAVHA
FT                   DAVQFRQLLQNLIGNGLKFHRDGVAPAVHVSARIEGQSAHFQVQDNGIGIERQYFDRIF
FT                   AVFQRLHTRDRYQGTGVGLALCKRIVERHGGQIWLDSVPGEGTTFHFTLQLPLTETEAA
FT                   GV"
     atgaccgtct caaattccca gggtaacgac ctgctgacca gcgacctgct ctcggtcgcg        60
     ctggatgcgt ttatcggcat tgatcagcat ggccgggtga tcgagtggaa tcctgcggca       120
     gagcggacgt tcggttatac acgtcaggaa gcgctgggcc aggcgatgaa tgagctcatc       180
     attccacccg ctttccaggc ggcccatcag cacggcatgg cccggtatct ggaaacagga       240
     ttagcgaaag tgctgtatca gcgtctgcgg cttgaggcgc agcgccgtga tggcgagatc       300
     tttccctgcg aactggtcat ccatgaagtc cagatccagg gtgcaagatc attcattgcg       360
     tcactgcgcg acctgaccga acaggtacgc gcggaaacag cacttcgcaa gcgtgaggca       420
     gaccaccgga cccttatcga gaacacagcc gtgggggtcg cgcgcgttga catcgagggc       480
     cgttggctgg aggtcaatcc agcaatcgag cgcttccttg gatatagcga ggctgaactg       540
     cggggcctga cattcagaga tgtcagccac ccggacgacc tgagtcagca caatgtgggc       600
     ctcttttcga ggctcgtcaa cggtgagggc ggtacgttta ccctggagaa gcggtacatc       660
     cgcaaagacg gcgtggtggt ctggggcagt gtgacggtct ctccagtggt cgatccggtg       720
     accggatacc ggtcaacggt ggcggtcatt catgacatca ccgaccgcaa acgcgccgag       780
     gagtacaccg agcggctgca ccgggtcact gctgaccttg cacgtgcact gacgccggag       840
     gctgtgctgg acgtcactct ggcggaagtg atgccagcta tgggcgccgc tgctggaggg       900
     gctttgctga tcgacgactc tgaagattat ctggaggcgc tcggtcatgc cggatatagc       960
     gaggaaatgg aacgccggtt cagccgggtt ccgctgacca tgtccctccc tgttacagac      1020
     actgcccgca ccggcgagcc ctattttctg accagtcagg agctcctgga acgctacccg      1080
     cacctcgcgg ggcagcgtga acagttcagg agcggagccg ggctgcccct gcgtgtcggt      1140
     gaccagatca caggtgttct ggtgctcagt ttcagtgacg accggctctt cagcggcgcc      1200
     gaccagacat tcatgacgtc cgtggcagac cagtgtgcac aggctatcga gcgcgcgcgg      1260
     ctgtacgagg tttcgcgcat tagcgttcag cggtaccgct cgctggtgga aaccaccagc      1320
     cggattgtct ggacccgttc gcctgagggc acctttgatc acgatcaacc gcagtggaca      1380
     gcgttcaccg gccagcggag ccccgagctg ctgggcatgg gctggctgga cgccgtccat      1440
     ccggaggacc gtgcacgaac tgcggacagc tggcaaaacg ctgtcagcag cggcacgccc      1500
     tatgagacca agtaccgcct gcgccgggcg gacgggatgt tccggcacat gcatgtgcgc      1560
     gccattcccc tccgcgacga cgacggtacg ctgcgcgagt ggattggggt ccacacggac      1620
     atcaccgagc gcctggaagc agaactggcg ctgcgcgaaa gccagggacg actccggttt      1680
     gccctggaag ccgcccagct tggggactgg gagatgagcc tgcacgatca ttcgttcaga      1740
     cagtctcccc ggcacgacga gatctttggc tatccgcagg ggcgtcccca ctggacctac      1800
     gaaacctttc tggagcatgt ccttcccgag gaccgtgagg atgtgaaccg caaattcacc      1860
     tgggccatgg aacaggaaga ggcctgggat attgagtgcc gcatccgccg cgcagatggt      1920
     gaggtgcgct ggatctggac gcgcggccag gctcaaaagc aaccgcacgg cagagcccgc      1980
     catatgctgg gcatcgtcgg tgacatcact gttctgaaac gcgctgaggc tgaggtgcgt      2040
     gcgctgaatg tgacgctcga gcagcgtgtc cgggagcgca cccaggaact ggagcggtcc      2100
     aaccgcgacc tggaacagtt tgcctatgtc gcgtcgcatg acctgcagga accgctgcgc      2160
     acggtcacga gctataccga actcctggcc cgccgctacg ggggccagct tgacgaaaaa      2220
     gccgagaagt acatgacatt taccgtggcc gccgcacggc gtatggggca actggtgcag      2280
     gacctgcttg atttttcgcg ggtacgcgcc gaaaatcatc aggtttcgag gctcgacccc      2340
     aatgaagtga tggttacgct gatccgcgac ctggaggaga ccattgaagc caatggagcg      2400
     gccgtcagct gggacaacct gcctgcagtg cacgccgacg cggtgcagtt ccgtcagctg      2460
     cttcagaacc tgatcggcaa cggcctcaaa ttccaccggg acggcgtggc gccggcggtc      2520
     catgtcagtg cccggattga gggccagtcc gcacattttc aggttcagga caatggcatc      2580
     ggaattgagc ggcaatattt cgaccggatc tttgcagtgt ttcagcggct gcacacccgg      2640
     gaccgctacc agggaacagg tgtaggcctc gccctctgca agcggattgt cgagcgccat      2700
     ggtggacaga tctggctcga cagcgtcccg ggtgagggca ccacattcca tttcacgctt      2760
     cagctgcccc tcacagaaac ggaggctgct ggtgtttaa                             2799
//

If you have problems or comments...

PBIL Back to PBIL home page