(data stored in ACNUC7421 zone)

EMBL: CP001115.PE34

CP001115.PE34        Location/Qualifiers
FT   CDS_pept        complement(53846..54235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00280"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47424"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1Y5"
FT                   /protein_id="ACO47424.1"
FT                   /translation="MVEALGVTFAWSTSEDALSFRSEWDPVPWVTYHSTMIFSDGFLRG
FT                   LRLDPTDLEVCGVGRNVYRCMRFGSFWMVQSPEGLGNESAALTWDAINGRYAADQALVF
FT                   ALQRVSGMHQDAVQAWLDDGARRRS"
     gtggtggaag ccctgggagt gaccttcgcc tggagtacat ctgaagacgc gctgagcttc        60
     aggagcgagt gggacccggt gccgtgggtg acgtatcact ccaccatgat tttcagtgac       120
     ggcttcctgc gcgggctgcg cctggacccg acggacctgg aagtgtgtgg ggtgggtagg       180
     aatgtgtacc gctgtatgcg tttcggttcg ttctggatgg tgcagtcgcc ggaaggcctc       240
     gggaatgagt ctgcggccct gacatgggat gccatcaacg gacggtacgc ggcggatcag       300
     gcgctcgtat tcgccttaca gcgggtgtcg ggcatgcatc aggacgccgt gcaggcgtgg       360
     ctggatgacg gagcacgcag aaggtcgtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page