(data stored in ACNUC7421 zone)

EMBL: CP001115.PE4

CP001115.PE4         Location/Qualifiers
FT   CDS_pept        2707..3528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00030"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47393"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1V4"
FT                   /protein_id="ACO47393.1"
FT                   /translation="MTNTASRRFDNRVVLVTGAAGGIGRAVAERFASEGARVAVNDIQV
FT                   NAVREVVGSITASGGSALAVPADVADASQVDHMFTQIESTFGYVDVLYNNAGLIDTARH
FT                   FLEADEAWWDRIIQVNLKSVFLCSHRAARTMVRRRRGVIISTSSGGATRAHRGNVAYDA
FT                   TKGGIEAMTRAMALDLAPYGVRVNGVVPGFINTYGLTDEQLRVREKTVPLGRYGVAEDM
FT                   TGAALFLASDDAVYITGQFISVDGGVLVQQRSANVDTFPVEGFPVVEADLL"
     atgaccaaca cagcttcccg ccgatttgac aaccgcgtcg tactggtgac tggtgccgct        60
     ggaggcatcg gtcgcgccgt tgccgagcgc ttcgccagcg agggcgcacg tgttgccgtc       120
     aatgacatac aggtcaacgc cgttcgagaa gtcgtggggt ctatcacggc gtcaggtggt       180
     tcggcgctgg ctgtacctgc tgatgtcgcg gacgcctcgc aggtcgacca catgttcacg       240
     cagatcgagt cgacctttgg atatgtcgat gtgctgtaca acaacgctgg cctgattgat       300
     accgcgcggc actttctgga ggcagacgag gcgtggtggg accgtatcat ccaggtcaac       360
     ctgaaaagtg tctttctatg ctcacatcgg gccgcccgca ccatggtccg gcgtcggagg       420
     ggcgtgatta tcagcacctc gtcaggcggc gcaacgcgcg cgcaccgcgg aaatgtcgcc       480
     tatgacgcaa cgaaaggggg aattgaagcc atgacgcgcg ccatggccct ggatctggcg       540
     ccctatggtg tgcgggtgaa cggcgtggtg ccgggtttca tcaacaccta tggcctcaca       600
     gacgaacagt tgcgagtccg ggagaagacc gttccgctgg gccgctacgg tgtggctgag       660
     gatatgacgg gagcagccct gttccttgca tctgatgacg ccgtgtatat aactggtcag       720
     tttatttcgg tagacggtgg ggtgctggtg cagcagcggt ccgcaaacgt ggataccttc       780
     cctgtggaag gcttcccggt ggtcgaggcc gacctgttgt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page