(data stored in ACNUC7421 zone)

EMBL: CP001115.PE47

CP001115.PE47        Location/Qualifiers
FT   CDS_pept        69343..69765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00382"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00382"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47438"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1Z9"
FT                   /protein_id="ACO47438.1"
FT                   /translation="MEFSMTARDAPVTGVAVSSVLLTLKLLVTVRLLNGLVSTGAPNPD
FT                   QVTRVQLTRELRALSESSTMGAQAADHISTRLTAALSRADQDENARISPLGTPGKERDR
FT                   LHLTKTVPPKSGSQGGPNHAGREIRTATPPQDQATG"
     atggagttct ccatgaccgc aagagacgcg cccgtgacgg gagttgccgt gagttcggtg        60
     cttctaaccc tgaaactcct ggtgactgtc cggcttctga atggcctcgt cagcaccgga       120
     gccccgaacc cggaccaggt gacccgtgtg cagctcacac gggagcttcg cgccctgtcg       180
     gaatcgtcca cgatgggcgc acaagctgca gaccacatca gcacacggct gaccgcggcc       240
     ctgtcacgcg ctgatcagga cgagaacgct cgcatatccc ctttgggaac gccaggaaag       300
     gagagggatc gtcttcacct gaccaagact gttccgccca aaagtgggtc gcagggcggg       360
     ccgaaccatg ctggtcggga gattcgtacc gccactcccc cgcaggatca ggcgaccggt       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page