(data stored in ACNUC7421 zone)

EMBL: CP001115.PE51

CP001115.PE51        Location/Qualifiers
FT   CDS_pept        74494..74613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00420"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47442"
FT                   /db_xref="UniProtKB/TrEMBL:C1D203"
FT                   /protein_id="ACO47442.1"
FT                   /translation="MSCALHLTPLQSPSLHHHSRDMFTPATFQRRQARLLVPH"
     atgtcctgtg cacttcacct gaccccgttg caaagcccat cgctgcatca ccatagccgg        60
     gacatgttca cgccggccac gttccagcgg cgccaggcac gcctgctggt gccacactga       120
//

If you have problems or comments...

PBIL Back to PBIL home page