(data stored in ACNUC7421 zone)

EMBL: CP001115.PE54

CP001115.PE54        Location/Qualifiers
FT   CDS_pept        79118..80317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00460"
FT                   /product="putative histidine kinase-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47445"
FT                   /db_xref="GOA:C1D206"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D206"
FT                   /protein_id="ACO47445.2"
FT                   /translation="MPDHEHHIASEIQALQQQINTLEADLQACQHQGMTLFSEAPAPYV
FT                   LLNSQGRIQDVNRAATGLLGRHREVLLGRHFSQFLTPASQGSFELLLGQAVGHGLSRRG
FT                   EAQLNHADGSMFDVLLDLDAEHIDGEFQRFRLVITDITAYKQAHAGLLDNTAAQQEQLE
FT                   VHSARIRELNQELEQIVTVFIQQLHLPLTRALNFLGLTRRALGEVADEVNQPLLNTERA
FT                   VQQIIALMASIERFMQMRSMRVRLRSVDLNSVLREVRKHSRPLMADRNIDITSEPLPTV
FT                   QGDSRALYLILDEYISNALKFTKEKDPARIHVRVQESESEYHIGVEDNGAGFNMRQKDQ
FT                   LFRLFGRLHSSKVYEGSGVGLMTVRRACMRFGGRVWAEGKVNQGATFWFAWPKQPVIRD
FT                   "
     atgcccgacc acgagcacca catagcatcc gagatccagg cgcttcagca acaaatcaac        60
     actctggaag ccgaccttca ggcttgccag caccagggga tgacgctgtt cagcgaagcg       120
     ccggcaccct acgtgctgct gaattctcag ggccggattc aggatgtcaa tcgtgcggcc       180
     acagggttgc ttggtcgtca ccgtgaggtt ctgctgggaa gacatttcag tcagtttctg       240
     actcctgcgt cacagggatc gtttgaactg ctgctcggtc aggcagttgg gcacggactc       300
     agccgccggg gcgaagcgca gctgaatcat gccgatgggt ccatgtttga tgttctgctg       360
     gatctcgacg cggaacatat cgacggtgaa tttcagcgct tccgcctcgt gatcacagac       420
     atcaccgcgt ataagcaggc gcatgccggg ctgctggata atacggcggc tcagcaggag       480
     cagctggaag tacacagcgc ccggatccgt gagctgaacc aggaactcga gcagatcgtt       540
     accgttttta ttcagcaact ccacctgccg ttgacgcgcg ccctgaattt tcttggcctg       600
     acgcgacgtg cgctgggaga ggtggcggac gaagtcaacc agccgctgct gaatacggaa       660
     cgagccgtcc agcagataat cgccctgatg gcgtctatag aacgcttcat gcagatgcgc       720
     tccatgcgtg tgcgtctgcg gtccgtcgac ctcaacagcg tgctgcgtga agtacggaaa       780
     cattccaggc cgctgatggc cgaccggaac atcgatatta cgagcgagcc gctgccgacg       840
     gtgcagggcg actcccgggc gctgtatctg attctcgacg agtacatctc aaacgcactc       900
     aaattcacca aggagaagga ccccgcccgg attcatgtcc gtgtgcagga gtccgaatcg       960
     gagtatcaca ttggcgtgga ggacaatggc gccggcttta acatgcggca gaaggaccag      1020
     ctgttccggc tcttcggccg gctgcattct tcaaaggtct acgagggctc gggcgttggt      1080
     cttatgacgg tgcgccgagc ctgtatgcgc ttcggtggcc gggtgtgggc tgaaggcaag      1140
     gtaaatcagg gcgcgacgtt ctggttcgcc tggcccaagc agcctgttat ccgtgattaa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page