(data stored in ACNUC7421 zone)

EMBL: CP001115.PE56

CP001115.PE56        Location/Qualifiers
FT   CDS_pept        81987..82349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00471"
FT                   /product="putative DsrE/DsrF-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00471"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47447"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C1D208"
FT                   /protein_id="ACO47447.1"
FT                   /translation="MAKLLVHVTCGPNDPTRAALAFLVARTAQEEGHPVTLFLAGDAVH
FT                   LLRPATLDALQGLGTGRLREHYDALRAGSAQFYLSGMSSAARGLAVSDLVQGSFELVKP
FT                   DVLVRLTFENDRVLSY"
     atggcgaagc tcctggtcca cgttacctgc ggtcccaatg atcccacgcg cgcagcgctt        60
     gcttttctcg ttgcgcgtac tgcgcaggag gaaggccacc cggtcacgct cttcctggcc       120
     ggtgacgccg tacacctcct tcgccctgca actctggatg ccctgcaggg cctggggacc       180
     ggcaggctcc gtgaacatta cgacgcgctc agggccggat ccgcgcagtt ttacctgtcg       240
     ggaatgtcca gtgctgcgcg cggtctggcg gtcagcgacc tggtgcaggg ttcgttcgag       300
     cttgtgaaac ctgacgttct ggttcgcctg acgtttgaga acgaccgcgt cctctcgtac       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page