(data stored in ACNUC7421 zone)

EMBL: CP001115.PE59

CP001115.PE59        Location/Qualifiers
FT   CDS_pept        complement(84175..84477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00490"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47449"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C1D210"
FT                   /protein_id="ACO47449.1"
FT                   /translation="MNASKNNDLSDQARKDALRAMLLRLISDGQLTDEELRLLIRTRNA
FT                   LDLSPEEVRSLRAEIYQAALQRAQQDGHIGGREAELLDRIVQFLNGGAWLTEHFE"
     atgaacgcca gcaagaacaa tgacctctcc gatcaggcgc gcaaggacgc cctgcgcgcc        60
     atgttgttgc gcctgatctc cgatgggcag ctgacagacg aggaactgcg tctgctgatc       120
     cgcacgcgta acgcgctgga cctgtctccg gaagaggtca gaagtctgcg cgcagagatc       180
     taccaggccg cgctccaacg ggcccagcag gacggacata tcggagggcg tgaggcggaa       240
     ctgctcgacc ggatcgtgca gttcctgaat ggtggcgcgt ggttgacaga gcattttgag       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page