(data stored in ACNUC7421 zone)

EMBL: CP001115.PE6

CP001115.PE6         Location/Qualifiers
FT   CDS_pept        complement(4713..5042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47395"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1V6"
FT                   /protein_id="ACO47395.1"
FT                   /translation="MHMQNIPFGTTDWAAVEETTHPGEQGVAYWRTRLFGDIRVRRVQY
FT                   VAGYVADHWCTKGHILLVLDGQLETTLEDGRSFTLTAGMSYQVADGAEAHRSSAPQGAT
FT                   LFIVD"
     atgcacatgc agaatattcc ctttggtacg accgactggg cagcggttga ggaaacgacc        60
     catcccggcg aacagggcgt ggcctactgg cggacccggc tctttggcga catacgggtt       120
     cgcagggtgc agtacgtggc cggatacgtg gccgatcact ggtgcaccaa agggcatatc       180
     ctcctggtgc tggatgggca gttggagacg acactggaag atggccgtag ctttacgttg       240
     actgccggaa tgagttacca ggttgcggac ggtgcggaag cccaccgctc gtctgcacct       300
     cagggtgcca ccctcttcat cgtggactga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page