(data stored in ACNUC7421 zone)

EMBL: CP001115.PE60

CP001115.PE60        Location/Qualifiers
FT   CDS_pept        complement(84518..84991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00500"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47450"
FT                   /db_xref="UniProtKB/TrEMBL:C1D211"
FT                   /protein_id="ACO47450.1"
FT                   /translation="MKPMLSCLLLTLALPSCAPANSVPSIPASIGLVCTGSSMGTLTRA
FT                   DSELSLVVNRAGEVSGSFTNNGTVFAAQGKAAVREDQRTLVVSQLSLSLDSTVEGRAGI
FT                   TASMGAVRTGVGLTGRLGSNGNLNGTLDAHGRFAGTFRGVQGTYRTLMNCGVN"
     atgaagccca tgctgtcctg ccttcttctc actctggcgc tgccctcatg cgctccagcc        60
     aacagtgtgc cgtctattcc ggcgtcaatt ggactggtct gtaccggaag cagcatgggc       120
     accctgaccc gcgctgattc cgagctgtcg ctggtggtca acagggctgg tgaagtcagc       180
     ggcagcttta ccaacaacgg cacggtcttt gccgctcagg gaaaagctgc cgtgcgggaa       240
     gaccagcgca ccctggtcgt cagccagctg agtctttcac tcgacagcac ggtggaaggg       300
     cgagcgggca tcactgcttc catgggcgcg gtacgcacgg gtgtgggcct gaccggccgt       360
     ctggggtcca acgggaacct gaatggcacg ctggacgccc acggtaggtt tgctggaacc       420
     ttccgtggcg tccaggggac ctaccgcaca ctcatgaact gcggagtgaa ttga             474
//

If you have problems or comments...

PBIL Back to PBIL home page