(data stored in ACNUC7421 zone)

EMBL: CP001115.PE62

CP001115.PE62        Location/Qualifiers
FT   CDS_pept        complement(86708..87061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00503"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00503"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47453"
FT                   /db_xref="UniProtKB/TrEMBL:C1D214"
FT                   /protein_id="ACO47453.1"
FT                   /translation="MTPLPGTCFGSQNSAVRTLVVPQGRATKGCLSISPLPDAEIKAAR
FT                   LRSGAQNCGGVQSHPSLRSRNFDVLLTGCPWEVSGSLTWGYRATRMTSASPHQTDVNRT
FT                   PNRPVAVTSAAMP"
     atgacaccgc taccagggac ctgctttgga tcacaaaata gtgccgtgcg aacgttggtc        60
     gtcccgcagg gccgggcgac caaggggtgc ttatccattt ccccccttcc ggacgctgaa       120
     atcaaagctg cgcgcctcag gtcaggcgcg cagaactgcg gtggcgtcca gtcacaccca       180
     tcgcttcggt cacggaactt tgatgtctta ttaactggtt gtccgtggga agtcagtggc       240
     tctctgacgt ggggatacag agcgacgcga atgacaagcg cctcccctca ccagacggac       300
     gtaaaccgca cgccaaaccg gcctgtggcc gttacttccg ccgccatgcc gtag             354
//

If you have problems or comments...

PBIL Back to PBIL home page