(data stored in ACNUC7421 zone)

EMBL: CP001115.PE67

CP001115.PE67        Location/Qualifiers
FT   CDS_pept        93566..96691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47457"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1D218"
FT                   /protein_id="ACO47457.2"
FT                   /translation="MSRREDLVHQISRRLAALSTRRGGLAVALWGDPGVGKSWTAAEVL
FT                   RALPLRSAEVQASAPLSSVIVSLPRPARLPVWTEEALRRLERREVIAPDDMGDVLTSLL
FT                   SELAPFVLYVKDLHEASAEQLRLWQAVAGGVTRSRGVGLMATSRQPPPAPFEVQALGLL
FT                   DQEETAVLLNQTLGACLPAEAAEWIGQHAAGNPLFSIEYLRFLIRQGCLWNDGERWHWR
FT                   APRESRIPTSVEALISHLCHTPPLSAPAQAALEARAMLTAGMAPAVWAQVAGLEATQLQ
FT                   HACEELDHRGILREGQFVHRLYQDVELHHLTPARRRLISRRAVSALLETDVEAAATFVV
FT                   HAELPGNDALPLLRRAAGSAQSGGRHRQAAEYLSQAVQHAHGGERAQLALAAARLWRDH
FT                   EPRRVIALAEEVLEIEPRNLDAAFLLAGALVLQGEEERATRLIRSLQDSAELEPLWLFQ
FT                   LISLHADRNDYVGVMTLWQEHPGLHHLAPPSVLAQVVRALDFVGQPTEACTLAAQALEH
FT                   RGLTGPERTALLFARCRALYSAGNLEAAEADASEVVTLTEAGQRVHECARGLSTRATIR
FT                   DTLGRYPEALADAQTSLKLFASLGVARDYAQQQSRLACLLLEYGDYEQAETLLHEGHEV
FT                   MKRAGVSHFLALCEYNLAYLYLEQNPPFGGTLALKYAHAGLQHARQAGSPLIVAQTAAM
FT                   AARAEAIHGTPQHALELADEALDLTQQLGTSHDTAWAIWARGFALEACGRPAEALASFQ
FT                   AAADELAGRGLTLWAHRLGLEADRLAGDATAAGAKLAFFREHELRNWVNVTGRYFPGLA
FT                   GEHPVQAPAPASVRLSVLGSVQLHRGAEALRYKGQKGKELLACLLEARLAGQHEVRQLT
FT                   LQETLYPELQDGAAVSALQQLVYRLRQVLGPEVIQRTDGGYRLGAAESDAEDFLRTNDA
FT                   RLWRGPYLEDLGAGQDAAVEEALYHALERQAHELLASDAREAARVGRILLEHDPYDQRM
FT                   LALTLRALQSSGNRRGGQKLYQEIAARFAEVGEVLVPLQALLERPLSNSRST"
     gtgagccggc gagaggacct cgttcatcag atcagcaggc gtctggcggc cctgagcacg        60
     aggcgcggtg gactggccgt ggccttatgg ggggatccgg gtgttgggaa gtcatggacc       120
     gctgcagaag tgctccgggc gctcccatta cgttccgccg aggtgcaggc cagtgcgcct       180
     ctgagcagcg tgatcgtcag cctgccgcgc ccggcacgcc ttccagtctg gacagaagaa       240
     gccctgcggc gtctggagcg ccgggaagtc atcgcgccag acgacatggg cgacgtcctg       300
     acttcactgc tgagcgagct ggctcccttt gttctgtacg tcaaggacct ccacgaagcg       360
     tcggcggaac agcttcggct ctggcaggcc gtggctggcg gcgtcactcg cagccgcggg       420
     gtcggcctga tggcgacaag ccggcaacca cctcccgctc catttgaagt gcaggcgctc       480
     ggtcttcttg atcaggagga aaccgccgtc cttctgaacc agaccctggg cgcctgcctt       540
     cctgcagagg ccgctgagtg gattggacag catgcagcag gaaacccgct gttcagcatc       600
     gagtacctgc gcttcctgat ccggcaggga tgtctctgga acgacggcga gcgctggcac       660
     tggcgcgcgc cccgggagag ccgcattccg accagtgtcg aggcgctgat ttcgcatctg       720
     tgccataccc ctccactgtc ggcgccggcc caagcggccc tggaggcgcg cgccatgctg       780
     acggccggga tggcgccggc agtctgggca caggttgccg gacttgaggc gacccagctg       840
     caacacgcgt gtgaggagct tgatcaccgg ggcatccttc gggaaggtca gttcgttcac       900
     cgtttgtatc aggatgtgga actacaccac ctgacgcctg ccagacgtcg gctgatttca       960
     cgccgcgctg tgagcgcgct gctggagacg gatgtggaag ccgccgcaac cttcgtggtt      1020
     cacgcggagc ttcccggtaa cgatgcgctg ccgctgctgc gccgcgctgc cgggtctgcg      1080
     cagtcaggtg gccggcaccg gcaggccgcc gagtatcttt cccaggcggt acagcatgcc      1140
     catgggggag agcgtgcaca gctggcactg gcagcagcgc gcctgtggcg ggaccacgag      1200
     ccgcgccggg tcattgccct ggccgaggag gttctcgaga tagagcccag aaacctggac      1260
     gctgcattcc tgctggcagg agcactggtt cttcagggcg aggaggagcg cgccacccgg      1320
     ctgatccgga gcctgcagga cagcgccgag ctcgaaccgc tgtggttgtt tcagctgatc      1380
     tcgcttcacg cggacaggaa cgactacgtc ggggtcatga cgctgtggca ggaacacccg      1440
     ggccttcacc atctggctcc gccttccgtg ctggcccagg tggtgcgcgc cctggatttc      1500
     gtcggacagc ccacggaagc gtgcacactg gcagcccagg ccctcgaaca caggggcctc      1560
     acgggccctg agcgcacagc gttgctgttt gcccggtgcc gggccctgta cagcgcagga      1620
     aatctcgaag ccgccgaagc ggacgcaagt gaagtggtga cgctgactga ggcaggccaa      1680
     cgggtgcacg agtgtgcccg cgggctctcg acccgggcga caattcgtga cacgttgggc      1740
     cgctaccctg aagcccttgc agacgcgcag acctcgctga aactgtttgc cagcctgggt      1800
     gtcgcgcgcg actatgccca gcagcagagc cgtctggcgt gcctgctgct ggaatatggc      1860
     gactatgagc aggccgagac gctgctgcac gagggccacg aggtcatgaa gcgtgctggg      1920
     gtctcgcatt tcctggcgct gtgcgagtac aaccttgcct acctgtacct tgagcagaat      1980
     ccgccgttcg gaggcacgct ggccctgaaa tacgctcatg ccggactcca gcatgcccgc      2040
     caggccggga gccccctgat tgtcgcgcag acagccgcca tggcagcgcg ggcagaggcg      2100
     atccacggca ccccccagca tgcgctggaa cttgcagacg aggccctgga cctcacgcag      2160
     cagcttggca cttcgcatga caccgcgtgg gccatctggg cccggggctt tgcgctggaa      2220
     gcgtgtggcc ggccggccga ggcgctggcg tcgttccagg cggcggctga tgaactcgca      2280
     ggccgggggt tgaccctctg ggcgcaccgg ctggggctgg aagcggaccg gctggctggt      2340
     gacgccactg cagcaggcgc gaaactggcg tttttccggg agcacgagct gcgcaactgg      2400
     gtcaatgtca cgggccgcta ctttcctggc ctcgcgggtg agcacccggt ccaggctccg      2460
     gcacccgcct ccgtccggct cagcgttctt gggtccgtcc agcttcatcg cggagcggaa      2520
     gcgctgcgct acaagggcca gaaggggaag gaactgctgg cctgcctgct tgaggcccgc      2580
     ctggcgggcc aacatgaagt cagacaactg acgctgcagg aaaccctcta cccggaattg      2640
     caggacgggg ccgcggtctc ggccctgcag cagctggtct accgtctgcg ccaggtgctt      2700
     ggaccggagg ttattcagcg caccgacggc gggtaccgcc tgggcgctgc cgagtctgac      2760
     gccgaagatt ttctcaggac caacgatgcg aggctgtggc gtgggcccta cctggaagat      2820
     ctgggggccg ggcaggacgc ggctgtggaa gaagcgctct atcacgcgct ggagcggcag      2880
     gcgcacgagt tgctggccag cgacgcgcgg gaagcggccc gggtgggccg gatcctgctg      2940
     gaacacgacc cgtacgacca gcgcatgctg gctctgacac tgcgcgcgct tcagagcagc      3000
     ggcaaccgcc ggggagggca gaagctgtat caggagatcg cagcacgctt cgctgaggtc      3060
     ggcgaggtgc ttgtgccgct gcaggccctc ctggaaaggc ccttatcgaa ctcccgcagc      3120
     acctga                                                                 3126
//

If you have problems or comments...

PBIL Back to PBIL home page