(data stored in ACNUC7421 zone)

EMBL: CP001115.PE68

CP001115.PE68        Location/Qualifiers
FT   CDS_pept        98814..99323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00562"
FT                   /product="hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00562"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26547"
FT                   /db_xref="UniProtKB/TrEMBL:X5HN67"
FT                   /protein_id="AHX26547.1"
FT                   /translation="MMRTMLSLVPLLVVLAACNPQTSTIPNPQDPYAGLPAPLPSARTE
FT                   GIFAAQTNAAVRVGGVTLQRGAVATYVDLQETDGRVQGFALFRGLDKREQRVELSGTSQ
FT                   DGKVTVPLSVNVCGENIDLTLYGTINPATTVNFAGGSRTVKCYGVNVTATVDPFKVDRV
FT                   PTGGAQ"
     atgatgcgaa caatgttgtc cctggttccc cttttggtgg tgcttgccgc ctgtaatccc        60
     caaacctcca ccatcccaaa cccacaggat ccctacgctg gactgccggc cccactgccc       120
     agcgcgcgga cggaaggaat attcgccgct cagacaaacg cggccgtgcg cgtcggaggg       180
     gtaacgctgc aaagaggagc cgtcgccacc tacgtggacc tgcaggagac cgacgggcgt       240
     gtgcagggat ttgcactgtt ccggggcctc gataagcgcg agcagcgcgt cgaactctcg       300
     ggaacaagcc aggacggaaa ggtcaccgtc cctctttcag tgaacgtctg cggagagaat       360
     attgacctca cgctgtacgg caccatcaat cccgccacca ccgtcaactt tgcgggaggc       420
     tccaggaccg tgaagtgcta tggcgtaaac gtcacggcta cggttgatcc cttcaaggtt       480
     gaccgcgtgc ctactggcgg tgcccagtga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page