(data stored in ACNUC7421 zone)

EMBL: CP001115.PE69

CP001115.PE69        Location/Qualifiers
FT   CDS_pept        99320..101044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00561"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00561"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47459"
FT                   /db_xref="UniProtKB/TrEMBL:C1D220"
FT                   /protein_id="ACO47459.1"
FT                   /translation="MNRRLKLAALLLSPLIGACSMPNIESAGISVAPGSLQLSAPEVNV
FT                   PLGGSGKVSVKVIKNCISPEEQATADIILAKVTPDGCHYVDENGEQRDHKENVWVGTQF
FT                   SSTPEPSIYDSNPKPEIWYTGKIPDGLSIQWANQPAEEQRGEVILAGKQGDISSTELTV
FT                   RTTSTVKPGSYVLHVTDNSSGRHNSAHNVKLTVNVTAPVPKSITGISASAQPTTITAGQ
FT                   TALMSASLTGTGDFDRTVRWSVMSGGGSLSASTGASVTYTSPSQATTAIIRAASAANPS
FT                   VYKDLTVTVKPPPPTITGVSVTATPTTIPSGGSSTLRATVSGTNNFNPAVTWSIVSGGG
FT                   TLSSTSGDTVTLTAPAGPANITVRASSVADMSKNDTVTVEVAAPDPQPGTAQLEGTITN
FT                   WNASSTGGQVSIETSNADHTALTVLSSAPVNQNGTFTLTLPVPSTLDPYTIDFGQSCTK
FT                   NVQPADLRVAGGSLYVTRDNVKRYLDSDASVRLSFLIYVDRAGSVDAQCTSTYTKPDGT
FT                   VMTERVEYKYTFAAAGWYPVYLTVSQTNATTTVYTHTSGPLSGAPSSYIESDPVATP"
     gtgaatcgcc gcctgaagct tgccgcgctg ctgctgtccc cattgattgg ggcgtgcagc        60
     atgcccaata tcgaatctgc tgggatctca gtcgctcctg gaagcctgca actcagtgct       120
     cccgaagtga acgtgccgct gggtggcagc ggcaaagttt ctgtcaaagt catcaaaaat       180
     tgcatcagcc cagaagagca ggccaccgcc gatatcatcc ttgccaaggt gacgcctgac       240
     ggctgtcact acgtcgatga aaacggcgaa cagagggatc acaaagagaa cgtttgggtc       300
     ggcacacaat tctcaagcac gcctgagccc tcaatctacg acagcaatcc gaaaccggaa       360
     atctggtaca cgggaaaaat accagacggt ctttccattc agtgggctaa tcagcctgct       420
     gaggagcaac ggggtgaggt tattcttgcc ggaaagcagg gggacatctc ctcaacggaa       480
     ctcacggtcc ggactacttc cactgtgaaa ccaggaagct acgtcctgca tgtgaccgac       540
     aattcatcag gccgacataa ctcggctcac aacgtcaagc tgaccgtaaa cgtgacggca       600
     ccggtgccca aatcaattac gggcattagc gcaagcgccc agcccacgac gatcacggca       660
     ggccagaccg ccctgatgag tgcctccctg accgggacag gggatttcga ccggacagta       720
     cggtggagcg tcatgagcgg cggcggaagc ctgagtgcgt ctactggagc ctctgtgacc       780
     tacacctctc cttcacaggc cacgacagcc atcatccgcg cggccagcgc cgccaatcca       840
     agcgtgtaca aggacctgac tgtgacggtc aagcccccgc caccgaccat caccggcgta       900
     agtgtcacgg caacgccgac aaccattccg agtggcggca gcagcactct gcgggccacc       960
     gtcagcggca ccaacaactt caacccggcg gtgacctgga gtatcgtgag cggcggcggc      1020
     acattgagca gcaccagcgg agatacggtc acgctgacgg ctccagctgg cccagcaaat      1080
     attacggtgc gtgccagcag cgtagctgat atgagcaaga acgacaccgt tacggtagag      1140
     gtagcggcgc ctgatcccca gcccggtacg gcgcagcttg aggggaccat cacgaactgg      1200
     aacgcgagct cgaccggtgg gcaggtaagc attgaaacat caaacgctga ccacacggca      1260
     ctaacggtgc tgagcagcgc ccctgtaaac cagaacggca cgtttaccct gaccctgccc      1320
     gtaccgtcga ccctggaccc ctacaccatt gattttgggc agagctgcac caagaacgtt      1380
     caacctgccg atctgcgggt ggccgggggc agcctctacg tcacgcggga caatgtcaaa      1440
     cggtatctcg acagtgacgc cagtgtccgc ctgtcattcc tgatctacgt agatcgcgcg      1500
     ggcagcgtag acgctcagtg caccagtacc tacacaaagc ctgacggaac ggtcatgacc      1560
     gagcgtgtgg aatacaagta caccttcgcg gccgccggtt ggtacccggt gtacctcacg      1620
     gtgtcgcaga ctaacgccac caccactgtg tacacccaca ccagcgggcc cctcagcgga      1680
     gcccccagca gctacatcga gtcggatccc gtcgctaccc cctga                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page