(data stored in ACNUC7421 zone)

EMBL: CP001115.PE70

CP001115.PE70        Location/Qualifiers
FT   CDS_pept        101377..102051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00580"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47461"
FT                   /db_xref="GOA:C1D222"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniProtKB/TrEMBL:C1D222"
FT                   /protein_id="ACO47461.1"
FT                   /translation="MSQQSPDHHSKRDLFSDLIGRTRFVVLIAVIAVLLVSFSLFLQGT
FT                   FLALHTIYETWHDMLTKGISSQSGTLAVEFLEVVGTMLKAVVFYLIGVGLYSLFIKPLN
FT                   LTSALGVESLSDLEQKVVSVIIVILGVTFLEHFIRWQNPLETLYFAGSLALAGGALVFF
FT                   QTVHRGKGSDLQQPEAKLRARRELFEHDTEQLVISERDVKRAEHATQAKIEGKVEAEAG
FT                   SE"
     gtgagccagc aaagccctga tcatcattcc aaacgggacc tgttcagtga cctgatcggc        60
     cgcacgcgtt ttgttgttct gattgcggtt attgcggtgc tgctggtttc tttcagtcta       120
     tttttgcagg gcacgttcct ggccctgcac accatctatg agacctggca cgacatgttg       180
     accaaaggca tctcaagcca gtcgggaaca ctggccgtcg agttcctgga ggtcgtgggc       240
     accatgctca aggcggtcgt gttctatctg attggtgtgg gtctgtactc gctgttcatc       300
     aagcctctga atctgacttc agctctgggt gtggaaagcc tgagtgacct tgaacagaaa       360
     gtcgtttccg tcattatcgt tattctcggc gtgacgtttc tggagcattt catccgctgg       420
     cagaatccac tcgaaaccct ttatttcgcg ggttcactgg cgctggcggg tggggcgctg       480
     gtgttttttc agacggtgca tcggggaaag ggcagcgacc tgcaacagcc ggaagcaaaa       540
     cttcgtgccc gccgtgagtt gtttgagcat gatacggagc agcttgtgat cagtgaacgg       600
     gacgtcaaac gggccgaaca tgccacccaa gccaaaatag agggcaaagt agaggctgag       660
     gccggctccg agtag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page