(data stored in ACNUC7421 zone)

EMBL: CP001115.PE73

CP001115.PE73        Location/Qualifiers
FT   CDS_pept        104941..105333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00610"
FT                   /product="putative ricin-type beta-trefoil lectin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47464"
FT                   /db_xref="GOA:C1D225"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C1D225"
FT                   /protein_id="ACO47464.1"
FT                   /translation="MCMDVQNGVATSTAQIQQWGCNGLPAQNFTLEQTAEGFYRLRSVL
FT                   GAQDMCLDNANGNSTPGTDVRLWSCNNAFAQNWHLEDMGHGYHRLIGQQTKLALDNPNG
FT                   STTAGTEIRTWSINGAAAQNWRLERR"
     atgtgtatgg atgtgcagaa tggtgtagcg acttccaccg cccagattca gcagtggggc        60
     tgcaatggtc ttccggcgca gaacttcacg ttggagcaga cggcagaagg cttctaccgc       120
     ctgagaagcg tgttgggtgc ccaggatatg tgtctggata atgctaacgg gaacagcacg       180
     ccgggtacgg acgtccgcct gtggagctgc aacaatgcct tcgctcagaa ctggcacctg       240
     gaagacatgg gtcacggtta tcaccggctg attggccagc agaccaaact ggccctcgac       300
     aaccctaacg gcagcaccac ggcaggtacg gaaatccgca cctggtccat caacggcgcc       360
     gccgcgcaga actggcggct cgaacgccgc taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page