(data stored in ACNUC7421 zone)

EMBL: CP001115.PE75

CP001115.PE75        Location/Qualifiers
FT   CDS_pept        complement(106341..107174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00630"
FT                   /product="putative LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47466"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C1D227"
FT                   /protein_id="ACO47466.1"
FT                   /translation="MQASLLAVFAHPDDEALRCGGTLARYAAQGAAVTLICLTRGEAGK
FT                   NTDPELLVTDLAAQREQELRDSCAQLGVAPPIFLGYHDSCRGERLRRDDPLATINADPL
FT                   EIEARILEVIALVRPQVMLTFDPHGIYGHPDHLVAHRAATAAFTSAGIHGHAVHRLFYV
FT                   VQTGEEMRRLQSGQALGVLSGLAPQTYAVCEATVAARIDVRAHAGQKRAALRSHRTQTG
FT                   PLSTLGNLSDAQIGPLLEQETFSLGGLRGPLSRYPVEDLFEGLDVTFHQEQLCRT"
     atgcaggcat cgctgctggc tgtctttgct caccccgacg atgaagcgct gcggtgcggt        60
     ggaaccctcg ccagatacgc tgcacagggc gcagctgtca ctctgatctg cctgacgcgc       120
     ggggaagccg ggaaaaatac cgaccctgaa ctgttagtga cggatctcgc cgctcagcgc       180
     gaacaggagc ttcgggactc ctgcgcacaa ctcggcgtgg cacccccgat ttttctcggg       240
     taccacgaca gctgccgcgg cgaacggctc cggcgggacg accccctcgc gaccatcaat       300
     gccgaccctc tggaaatcga ggcgcggatt ctggaagtga ttgccctggt gcggcctcag       360
     gtgatgctga ccttcgatcc gcacggtatc tatggccatc cggatcatct cgtcgcccac       420
     cgggcggcca cagcagcatt cactagcgcc gggattcacg ggcatgcggt gcaccgtctg       480
     ttttacgtgg tgcagacagg tgaggagatg cggcgcctcc aaagcgggca ggcgcttggc       540
     gtgctcagcg ggcttgcccc gcagacgtac gcggtgtgtg aagccacggt tgcagcccgg       600
     attgacgtcc gtgcgcacgc gggacagaag cgcgctgcgc tgcgttctca ccggacgcag       660
     accggcccac tgagtaccct cggaaacctg tcagatgcgc agatagggcc gctgctggag       720
     caggagacgt ttagcctggg tggcttacgc ggccccctgt cgcgctatcc ggtcgaggac       780
     ctgttcgagg gcctggatgt gacgttccac caggagcagc tgtgcaggac ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page