(data stored in ACNUC7421 zone)

EMBL: CP001115.PE81

CP001115.PE81        Location/Qualifiers
FT   CDS_pept        complement(112992..113306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00681"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00681"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47471"
FT                   /db_xref="UniProtKB/TrEMBL:C1D232"
FT                   /protein_id="ACO47471.1"
FT                   /translation="MRLAEDESYSPARCQEPCVVPANGRAVQKNLPRAAQPSSRRVVQG
FT                   SAQELPHSDFLTQRSPMALFPERWVGGRKVWSARIRRLSSSRVVAFRFCTTGTVMIVMV
FT                   "
     atgcggctag cagaagacga aagctactcg ccagcgcggt gtcaagagcc ctgcgtggtg        60
     ccagcgaatg gacgcgcggt ccagaaaaat ctgccccgcg ctgcccagcc atcttctcgc       120
     agagtcgtgc agggaagtgc tcaagagcta cctcactctg atttcctgac ccagagaagc       180
     cctatggccc tgttcccaga gcgctgggta ggtggaagga aagtgtggtc agcacggatc       240
     cgccgcttat cctccagccg cgtcgtagcc ttccgtttct gtacgactgg gaccgtgatg       300
     atcgtgatgg tgtga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page