(data stored in ACNUC7421 zone)

EMBL: CP001115.PE82

CP001115.PE82        Location/Qualifiers
FT   CDS_pept        complement(113893..114267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00682"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00682"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47472"
FT                   /db_xref="GOA:C1D233"
FT                   /db_xref="UniProtKB/TrEMBL:C1D233"
FT                   /protein_id="ACO47472.1"
FT                   /translation="MDMQFMGTVLVTASVAAFSWLTLRVWQIRSPKTARFLPLRFLHAF
FT                   TTVYFPLVAHSYLETLHRVQTEYANDAPNIAMAWGDHHNAVIFSRGAALVIAVYTVIIV
FT                   VTVRTHGQPDGAQLTFHQNH"
     gtggacatgc aatttatggg gaccgtactc gtcacggcca gcgtcgcggc cttctcctgg        60
     ctgaccctgc gtgtctggca gatccgttca ccgaaaaccg cacgcttcct tcctctccgc       120
     ttcctgcacg ccttcaccac tgtgtacttc cccctggtcg cgcacagcta tctggagaca       180
     ctccaccggg tacaaaccga atatgccaat gatgccccca atatcgccat ggcatggggt       240
     gatcaccaca acgcggtgat attttctcgt ggcgctgctt tggtgatagc cgtgtacaca       300
     gtcatcattg tggtaacagt ccgcacacat ggacaacccg atggcgcaca gcttactttc       360
     catcaaaatc actga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page