(data stored in ACNUC7421 zone)

EMBL: CP001115.PE9

CP001115.PE9         Location/Qualifiers
FT   CDS_pept        9165..9686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47398"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1V9"
FT                   /protein_id="ACO47398.2"
FT                   /translation="MNTRWVIVGLSLMIAGGMRTVAIQIPGTKVDYFAAQDSVTTDNRG
FT                   MVRIFEVNDTTGETFVRFACEGRVMQAYFHGKNPLLTPRAREIELYPLVVYQVDSQQLK
FT                   TLKASGTLDEGGTPALDSLAFENDELVVEAFRNAGERVILRIPRLGMSELTFTFAVKGF
FT                   REGLSRIKPC"
     atgaacacac gctgggtgat cgtagggttg agtctgatga tcgccggtgg catgagaaca        60
     gtggcgatcc agattccggg aaccaaagtc gactactttg ctgcccagga ttcggtcacc       120
     accgacaacc gtgggatggt ccggattttt gaggtcaacg acaccactgg cgaaacattc       180
     gtgcgatttg cctgcgaggg acgggtaatg caggcatatt tccatgggaa gaatccgctc       240
     ctgactccca gggcccggga aatagagctg tatcccctgg tggtgtacca ggtggatagc       300
     cagcagctca aaaccttaaa ggcatcgggg acgctggatg aaggtgggac cccggcgctt       360
     gattcactgg cattcgaaaa cgacgagttg gtggtggagg cgttccgtaa cgcgggcgaa       420
     cgggtcatcc tgcgcattcc gcgtctgggg atgtcagaac tcacttttac gtttgctgtg       480
     aaaggttttc gtgaggggct cagccggatc aagccctgct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page