(data stored in ACNUC7421 zone)

EMBL: CP001115.PE94

CP001115.PE94        Location/Qualifiers
FT   CDS_pept        130951..132498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47484"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C1D245"
FT                   /protein_id="ACO47484.1"
FT                   /translation="MTATPCITALQDTVRTLQAQIAAAEDGPEALALLHRDAAYAALDV
FT                   GDTAAAMTHALSCLDLARAVGEASLKAKAHVALALVQAEVYDDMGASQHFAQADALVRE
FT                   AGDDRGVALVAVNAAHYEMEREQSLAAVTRLQALLDSPQARGVDLGPTEDLKQVLHINY
FT                   LVSAAGAQLGGEVLPGAVTRQVGTSRALLETWLMNRQHLGQPLRVLEILEALTLVALMD
FT                   GQHERAAHLADERVRLAVQADGPLLVGRALLDRVRVHEAAGAWGAVEADARQAAIAFTS
FT                   AGHELFATRARERLAEALARQGQFQAAFNVQREATRQVYALYHGFYQQRALVGQIEQQA
FT                   RDAEVRATAFAEAALRDSLTGAPNRAHAMQVLAGLHAQARQGRGSAVVLMDLDHFKRVN
FT                   DTYGHAAGDDVLTRVVQVLGAEVRGMDCVARFGGEEFIIILPGVSLNAAEQVCLRLSQV
FT                   LAELEWPAIDPDLRVTGSFGVACLRDGATLTETLREADVALYRAKAAGRHTVRVLGP"
     gtgacggcta cgccatgcat caccgcgttg caggacacgg taaggacgct tcaggcgcag        60
     attgcggcgg cagaggacgg ccccgaagct ctggccctgc tgcaccggga tgcagcctac       120
     gcggcgctgg atgtcggcga cacggcggct gccatgacgc acgcgctgag ctgcctggac       180
     ctggcccgcg ccgtgggcga ggcgtccctc aaagccaaag cgcatgtggc gctcgcattg       240
     gtgcaggccg aggtgtacga cgatatggga gcgtcacagc acttcgcgca ggcggacgcc       300
     cttgtccgtg aggcgggcga tgaccgcggc gtggccctgg tggcagtgaa cgccgcgcat       360
     tacgaaatgg aacgcgagca gtctctcgcc gccgtcaccc ggctccaggc gctgctggat       420
     tcgccacagg cgcggggcgt ggacctcggc ccgaccgagg atctgaaaca ggttctgcac       480
     atcaactacc tggtcagcgc cgcgggagca caactggggg gcgaggtcct cccgggcgcc       540
     gtgacgcgtc aggtggggac atcccgggcg ttgctggaaa cctggctcat gaatcgccag       600
     cacctgggcc aaccattacg ggtgctcgaa atactcgagg cgctcacgct ggtcgccctg       660
     atggacgggc agcatgaacg ggccgctcac ctggccgacg agcgggtgag gctggccgtt       720
     caggcagacg gacccctgct ggtgggccgg gccctgctgg accgggtccg ggtgcacgag       780
     gcggcggggg cgtggggcgc ggtggaagcg gacgcccggc aggcggcgat cgccttcacg       840
     tcggcggggc acgagctgtt cgcgacgcgt gcacgcgagc ggctggccga agccctggca       900
     cgccagggcc agtttcaggc ggccttcaac gtgcaacgtg aggcgacgcg gcaggtgtat       960
     gccctgtacc acggcttcta tcagcaacgg gctctggttg ggcagatcga acaacaggcc      1020
     cgcgacgccg aggtgcgggc caccgcgttt gccgaagcgg ccctgcgcga ctcgttgacc      1080
     ggtgcgccga accgcgccca tgcgatgcag gtgctggccg ggttgcacgc ccaggcacgg      1140
     cagggacgcg ggagcgccgt ggtgctgatg gatctcgacc atttcaagcg tgtgaacgac      1200
     acttacggtc acgcggccgg ggacgacgtg ctgacccggg tcgtccaggt tcttggcgcg      1260
     gaggttcggg ggatggactg cgtggcccgc ttcgggggcg aggagttcat catcattctg      1320
     ccgggcgtgt ctctgaacgc cgcggagcag gtgtgtctgc gcctcagtca ggtgctcgcc      1380
     gaactcgagt ggccggccat tgacccggat ctgcgggtca ccggcagttt tggcgtggcg      1440
     tgtttgcgtg acggggccac cctcacggag accctgagag aggctgacgt cgcgctgtac      1500
     cgggcgaaag ccgccggccg gcatacggtt cgcgtattgg gcccctga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page