(data stored in ACNUC7421 zone)

EMBL: CP001115.PE97

CP001115.PE97        Location/Qualifiers
FT   CDS_pept        137021..138010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47488"
FT                   /db_xref="UniProtKB/TrEMBL:C1D249"
FT                   /protein_id="ACO47488.2"
FT                   /translation="MILLAHLVMGSAFAQSTQAPPPTSRPPAVAPVAPVSPAPSGSNTG
FT                   NTTTRTATDPCQQFSLSASGNTRLTPEQEAQRAASERRCIEANSGNPDVLLDIPNLSVE
FT                   EITLEVENLRANVALDARLANLLLLTAGADVSIDKVKLTIKGVRAQALLKVNLDNVARI
FT                   IDRTLTTIDRNPQILERLLTSVDNAVGTVGNVANTAVQPGGVVDRAVGTVGQTLNNVTQ
FT                   PGGVLTQTVNSLGQTVQRTIDATGNIVERTVTSAGQVLGQTLTVGNISSLKVLRETNNA
FT                   AGQIVRQLQDTTGAIFEVTLDKDNRVIAYRLLQAAPGTTPATPAPGGR"
     gtgattctcc tggcacacct tgtcatgggg tctgcctttg cccagtccac tcaggcgccc        60
     cctccaacgt ccaggcctcc tgccgtcgct cctgttgctc ccgtgtcacc ggccccttca       120
     ggcagcaata caggcaacac cacaacacgc actgcaacgg acccgtgtca gcagttcagc       180
     ctttccgcgt caggcaatac tcgcctgacg ccggaacagg aagctcagcg tgccgccagt       240
     gagcgccgct gcatagaagc gaattcaggt aatcccgacg tgctgctgga tattcccaac       300
     ctcagcgttg aggaaatcac cctggaagta gaaaacctcc gggcaaacgt ggcccttgac       360
     gcccgccttg ccaacctgct gcttctgacc gctggtgcgg acgtgtccat cgacaaggtc       420
     aagctcacca tcaagggcgt gcgtgcacag gctctgctca aggtcaacct cgacaacgtg       480
     gcacggatta ttgaccgaac gctgaccact attgaccgta atccccagat acttgagcgg       540
     ctgctgacca gtgtggataa cgcagtcggg acagttggga acgttgccaa cactgccgtt       600
     caaccagggg gtgtcgtgga ccgtgccgtt gggaccgtcg gacagacgct gaacaacgtc       660
     acgcagcctg gtggtgtgct gacccagacc gtcaacagcc ttgggcagac agtgcagcgc       720
     accattgacg ccaccggcaa catcgtggaa cgtaccgtaa cctccgccgg tcaggtgctc       780
     gggcagacgc tgacggtggg caatatcagc agcctgaaag tcctgcgcga aacgaacaat       840
     gctgcaggcc agatcgtgcg tcagctacag gacaccacgg gggccatctt tgaagtcact       900
     ctggacaagg acaatcgggt gatcgcctac cgcctgctgc aggccgcgcc agggaccact       960
     cccgcgacgc ctgctcctgg cgggagataa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page