(data stored in ACNUC7421 zone)

EMBL: CP001115.PE98

CP001115.PE98        Location/Qualifiers
FT   CDS_pept        complement(138162..138668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00833"
FT                   /product="conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00833"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26549"
FT                   /db_xref="UniProtKB/TrEMBL:X5GY69"
FT                   /protein_id="AHX26549.1"
FT                   /translation="MKRAIVLTTILTTCVIAAAQPPASLPPVTTGPAAAVSYTFEILDA
FT                   SRQPVATFDATGKLQVSGTLSTGTFLRLSRPGASRLFQLAQPVTPGTTLGEVVLVYGNS
FT                   TVTLGALLNGTSGTAESSRPSVTPQQLNALLGLSTSVGSVSVGMSTSLSVNGLPLTLPL
FT                   ILPLF"
     atgaaacgag ccatagttct gactacgatc ctgacgacct gcgtcattgc ggcggcacag        60
     cctcccgcct cgctgccgcc agtcactaca ggccccgctg ctgccgtgtc ctataccttt       120
     gagatcctgg atgccagtcg gcaaccggtc gccaccttcg atgcaacagg aaagctgcag       180
     gtctcaggaa ccctgtcgac aggcaccttc ctgcgtctgt caagacccgg agccagccga       240
     ctctttcagc tcgctcagcc tgtcactccg ggcaccacat tgggtgaagt tgtgctggtg       300
     tatggaaaca gcaccgtaac gttgggcgcg ctgctcaacg gaacgtcggg aactgcagaa       360
     agcagccggc ccagtgtcac gccacagcaa ctcaacgccc ttctgggcct gtctacctcg       420
     gtaggcagcg tgagcgtcgg gatgagcact tccctgagcg tcaacggcct gcccctgacg       480
     ctgcctctga ttcttccgct gttctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page