(data stored in SCRATCH zone)

EMBL: CP001163.FINO

CP001163.FINO        Location/Qualifiers
FT   CDS_pept        52994..53629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="finO"
FT                   /locus_tag="ECH74115_B0082"
FT                   /product="fertility inhibition protein"
FT                   /note="identified by match to protein family HMM PF05286"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34452"
FT                   /protein_id="ACI34452.1"
FT                   /translation="MKLTSCYDEPFQRPAGHIFTKVRVSMAEQKRPVLTLKRKTEGETP
FT                   VRSRKTIINVTTPPKWKVKKQKLAEKAAREAELAAKKAQARQALSIYLNLPTQDEAVNT
FT                   LKPWWPGLFDGDTPRLLACGIRDVLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMK
FT                   AGACRYDTEGYVTEHISQEEEAYAAARLDKIRRQNRIKAELQAVLDEK"
     ttgaaattaa cttcctgtta cgatgagccg tttcaacggc ctgcagggca tattttcacg        60
     aaggtcagag taagcatggc agagcaaaaa cgaccggtac tgacactgaa gcggaaaacg       120
     gaaggagaga cgcctgtccg cagccggaaa accatcatca atgtcaccac gccaccaaaa       180
     tggaaggtga aaaagcagaa gctggccgag aaagcagccc gggaagcgga gctggcggca       240
     aaaaaagcgc aggccagaca ggcgctgtcc atttatctga acctgcccac gcaggatgag       300
     gccgtgaaca ccctgaaacc ctggtggccg ggattatttg acggtgacac gccccggctt       360
     ctggcctgcg gtatccggga cgtgttactg gaagacgtgg cgcagcggaa tatcccgctc       420
     tcgcataaaa agctgcgcag ggcgctgaag gccatcaccc gttcagaaag ctatctgtgt       480
     gccatgaaag ccggtgcctg ccggtatgac acggaagggt atgtgacgga gcatatttct       540
     caggaggagg aagcgtatgc ggcagcgcgt ctggataaaa tccgccgcca gaaccggata       600
     aaggcagaac ttcaggccgt gcttgatgag aaataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page