(data stored in SCRATCH zone)

EMBL: CP001163.GSPC

CP001163.GSPC        Location/Qualifiers
FT   CDS_pept        81334..82209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="ECH74115_B0002"
FT                   /product="general secretion pathway protein C"
FT                   /note="identified by match to protein family HMM TIGR01713"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34434"
FT                   /protein_id="ACI34434.1"
FT                   /translation="MLFFLSFRGDRGLFIKDIVLKMLTPNRLLCVILLIAGYQLVSVIH
FT                   HFWLTQAASVPGLSRVSAPETAVTGDQTEERFVFTLFGRASPLSSEGRAQETMPSLSDD
FT                   LLSGEDLDVRGILYSSVAEHSVAIFAHNNRQFSLSVGEKVPSYDATISAIFSDHIVINY
FT                   QGKTVSLPLRYDNTEKKNAYDNNNLTVGDVITQDNFRVESVFDIMSFSAVTVNNTLSGY
FT                   RLIPGKHSSLFYNAGLHDNDLAVSVNGSELRDTRQAQQIMKQLPELKEIKITVERDGQL
FT                   YDAFIAVGEN"
     atgttgttct ttctatcatt ccggggtgac cggggcttat ttataaaaga tatcgtactt        60
     aaaatgctga cgccaaaccg gctattgtgc gtaattttac ttattgccgg atatcagctg       120
     gtgtcggtta tccatcattt ctggctgact caggcagcat cggtgcccgg cttatcccgt       180
     gttagcgcgc cggaaacagc ggtaactggt gatcaaactg aagaacgttt tgtttttacg       240
     ttattcggca gggcatcccc actatcatcg gaggggagag cgcaggaaac aatgccttcc       300
     ctgtcagatg atctgctttc aggggaggat cttgacgtga gaggtatact ttatagttcg       360
     gttgcagagc attccgttgc catatttgca cataataaca gacagttcag tctgagcgtc       420
     ggcgaaaaag tacccagcta cgatgctacg attagtgcta tttttagcga tcatattgtt       480
     attaactatc agggaaaaac tgtatcactg cctctgcgat atgataatac cgaaaaaaag       540
     aatgcatatg acaataataa tttaacagtt ggagacgtga taacccaaga taattttcgg       600
     gtagaaagtg tttttgatat tatgagcttt tcagccgtta cggttaataa tacattaagc       660
     ggttatcgct tgattccggg taagcacagt tcgttatttt ataatgctgg gttgcatgat       720
     aacgatctgg ccgtatcggt taatggttca gaattgcgtg ataccagaca ggcgcagcag       780
     ataatgaagc aattgccaga acttaaagaa ataaaaataa ccgtcgagcg tgatggtcag       840
     ttatatgatg catttattgc tgtaggagaa aactga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page