(data stored in SCRATCH zone)

EMBL: CP001163.GSPD

CP001163.GSPD        Location/Qualifiers
FT   CDS_pept        82210..84177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="ECH74115_B0003"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02517"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34510"
FT                   /protein_id="ACI34510.1"
FT                   /translation="MFRKWLNGRLPVLVFTTVILGAIPGWGAEFSANFKDTDIQEFINT
FT                   VSKNLHKTVIINPDVQGTITVRSYDMLNEEQYYQFFLSVLDVYGFAVVDMHNGILKVVR
FT                   SKDAKTSAVPVASDVSPGTGDEVVTRVVPVSNVAARDLAPLLRQLNDNAGAGSVVHYEP
FT                   SNVLLMTGRAAVMKRLMEIVERVDKVGNRSVATVPLTYASATDVARLVTELTKETDKTA
FT                   IPAWMTAKLVADERTNSVLVSGEPISQQRIISIIKQLDRQEDVQGNTKVIYLKYAKAKD
FT                   LVEVLTGISSSIENDSKKSPSTEALRKGVTIKSHEQTNALILTGAPDVIRDLENVISQL
FT                   DIRRPQVLVEAIIAEIQDADGLNLGIQWVNKHAGVAQFTSTGLPITTMVQTRQNEILDS
FT                   DQSNALSMFNGIAAGFYQGNWAMLLTALSTSSKNDILATPSIVTLDNMEATFNVGQEVP
FT                   VLSGSQTTSGDNIFNTVERKTVGIKLRVKPQINEGDSVLLEIEQEVSGVADTAVATTTD
FT                   LGATFNTRTVTNAMLVGNGETVVVGGLLDKSIRGSESKVPLLGDIPVLGHLFRAKSEQT
FT                   AKRNLMLFIRPTIIRERDGFRHASAEKYQSFNQEQVQSRGKETTALTLNEEQLRLSPDQ
FT                   DDTAFRKVKAAIAAFYAQEM"
     ttgttcagga aatggttgaa tgggcgtttg ccggtacttg tgttcactac agtaattttg        60
     ggggccattc cagggtgggg ggctgaattt tcggccaact ttaaagatac ggatattcag       120
     gagttcataa atactgtcag taaaaattta cacaaaacgg taataattaa tcctgacgtg       180
     cagggaacca tcactgtacg cagctacgat atgctgaacg aggaacaata ttatcagttc       240
     tttctcagtg tgctggacgt ttatggtttt gctgtggtcg atatgcacaa cggtatactg       300
     aaagtagtgc gctcaaaaga tgccaaaacg tcggcggtgc cggtagctag tgatgtcagt       360
     cccgggactg gtgatgaggt tgttacccgg gtggtccccg taagtaacgt ggcagccaga       420
     gatctggcgc ctttgctgcg tcagctcaat gataatgctg gcgcaggaag cgtggtgcat       480
     tatgaacctt ctaatgtttt gttgatgacc ggacgtgctg cagtgatgaa acggttgatg       540
     gagattgttg aacgtgtgga taaggtgggt aatcgcagcg ttgccacggt cccgctcacc       600
     tacgcgtccg caacagacgt agccagactt gttacggaac tgactaaaga aacagataag       660
     acagctatac ctgcttggat gacggcgaaa ctggttgcag acgagaggac aaactcagtg       720
     ctcgtcagcg gagagccaat ctcccaacag cgtatcatct ccataattaa gcaactggat       780
     cgtcaggagg atgttcaggg taatactaag gtgatttacc tgaaatatgc gaaggcgaag       840
     gatttagtgg aagtcctgac aggtatcagc agcagtattg aaaacgactc taaaaagagt       900
     ccgtcaacgg aagccttgcg caaaggagtg acgattaaat cccacgaaca aaccaatgcc       960
     ctgatcctga cgggggcccc tgacgtcatc cgcgaccttg aaaatgtgat ttcgcagttg      1020
     gatattcgtc gtcctcaggt cctggtggag gccatcattg ctgaaataca ggatgctgac      1080
     gggctgaacc ttgggatcca gtgggtgaat aaacatgccg gtgtggcgca gttcaccagt      1140
     accggtttac ctattaccac gatggttcag actcgtcaga acgaaatctt agacagcgat      1200
     cagagcaatg ccctgagcat gtttaacgga attgcagcgg ggttttatca gggaaactgg      1260
     gcgatgctgt tgacggcgct ctccacaagt agcaagaatg atatcttggc gacccccagt      1320
     attgtcacgc tggacaatat ggaggccact ttcaatgttg gtcaggaggt cccggtactt      1380
     tcgggctcac agacaacctc tggggacaat atttttaaca cggtcgagcg caaaacggtg      1440
     gggatcaaac tcagggtaaa accccagatc aacgagggtg attccgtgtt actggagata      1500
     gaacaggagg tgtccggtgt ggcggacact gcagtagcca ccactactga cttgggagca      1560
     accttcaaca cccgaacagt gaccaatgcc atgctggtcg ggaatggcga aacggtggtg      1620
     gtcggaggat tactggataa gtcgatcagg gggagtgaga gtaaagtgcc actgctgggg      1680
     gatatcccgg tactggggca tctttttcgc gcaaaaagcg aacagacagc taagcgtaat      1740
     ctgatgctgt tcattcggcc aactattatt cgtgagcgcg acggatttcg tcatgcttcg      1800
     gccgaaaaat accagtcgtt taatcaggaa caggtgcagt cgcgtggcaa agaaacaacg      1860
     gcgctgacgc tgaatgagga acagctcagg ctgtcccccg atcaagacga tacggctttc      1920
     cggaaggtga aagcggcgat tgctgcgttt tatgcgcagg agatgtaa                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page